Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   P3T75_RS10965 Genome accession   NZ_CP120467
Coordinates   2268015..2268500 (-) Length   161 a.a.
NCBI ID   WP_282461602.1    Uniprot ID   -
Organism   Enterococcus montenegrensis strain CoE-012-22     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2248981..2290979 2268015..2268500 within 0


Gene organization within MGE regions


Location: 2248981..2290979
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  P3T75_RS10830 (P3T75_10825) - 2248981..2250015 (-) 1035 WP_282461580.1 methionine ABC transporter ATP-binding protein -
  P3T75_RS10835 (P3T75_10830) - 2250406..2250744 (-) 339 WP_282461581.1 glycine cleavage system protein H -
  P3T75_RS10840 (P3T75_10835) - 2250746..2251102 (-) 357 WP_206902320.1 arsenate reductase family protein -
  P3T75_RS10845 (P3T75_10840) - 2251147..2252340 (-) 1194 WP_282461582.1 FtsW/RodA/SpoVE family cell cycle protein -
  P3T75_RS10850 (P3T75_10845) - 2252756..2252995 (-) 240 WP_173102292.1 hypothetical protein -
  P3T75_RS10860 (P3T75_10855) - 2253658..2254872 (+) 1215 WP_282461583.1 LysM peptidoglycan-binding domain-containing protein -
  P3T75_RS10865 (P3T75_10860) - 2254915..2255658 (-) 744 WP_282461584.1 N-acetylmuramoyl-L-alanine amidase -
  P3T75_RS10870 (P3T75_10865) - 2255659..2255967 (-) 309 WP_282461585.1 hypothetical protein -
  P3T75_RS10875 (P3T75_10870) - 2255960..2256364 (-) 405 WP_282462603.1 holin family protein -
  P3T75_RS10880 (P3T75_10875) - 2256408..2256551 (-) 144 WP_282461586.1 XkdX family protein -
  P3T75_RS10885 (P3T75_10880) - 2256553..2256900 (-) 348 WP_282461587.1 hypothetical protein -
  P3T75_RS10890 (P3T75_10885) - 2256894..2257349 (-) 456 WP_282461588.1 hypothetical protein -
  P3T75_RS10895 (P3T75_10890) - 2257351..2257636 (-) 286 Protein_2120 hypothetical protein -
  P3T75_RS10900 (P3T75_10895) - 2257633..2258358 (-) 726 WP_282461589.1 hypothetical protein -
  P3T75_RS10905 (P3T75_10900) - 2258351..2259178 (-) 828 WP_282461590.1 phage baseplate upper protein -
  P3T75_RS10910 (P3T75_10905) - 2259171..2259656 (-) 486 WP_282461591.1 CHAP domain-containing protein -
  P3T75_RS10915 (P3T75_10910) - 2259669..2262449 (-) 2781 WP_282461592.1 phage tail spike protein -
  P3T75_RS10920 (P3T75_10915) - 2262446..2263186 (-) 741 WP_282461593.1 phage tail protein -
  P3T75_RS10925 (P3T75_10920) - 2263186..2265753 (-) 2568 WP_282461594.1 tape measure protein -
  P3T75_RS10930 (P3T75_10925) - 2266159..2266566 (-) 408 WP_282461595.1 transcriptional regulator -
  P3T75_RS10935 (P3T75_10930) - 2266567..2266734 (-) 168 WP_282461596.1 hypothetical protein -
  P3T75_RS10940 (P3T75_10935) - 2266731..2266856 (-) 126 WP_282461597.1 hypothetical protein -
  P3T75_RS10945 (P3T75_10940) - 2266853..2267035 (-) 183 WP_282461598.1 hypothetical protein -
  P3T75_RS10950 (P3T75_10945) - 2267235..2267444 (-) 210 WP_282461599.1 hypothetical protein -
  P3T75_RS10955 (P3T75_10950) - 2267441..2267659 (-) 219 WP_282461600.1 hypothetical protein -
  P3T75_RS10960 (P3T75_10955) - 2267656..2268003 (-) 348 WP_282461601.1 NUMOD4 domain-containing protein -
  P3T75_RS10965 (P3T75_10960) ssbA 2268015..2268500 (-) 486 WP_282461602.1 single-stranded DNA-binding protein Machinery gene
  P3T75_RS10970 (P3T75_10965) - 2268497..2269408 (-) 912 WP_282461603.1 conserved phage C-terminal domain-containing protein -
  P3T75_RS10975 (P3T75_10970) - 2269436..2270077 (-) 642 WP_282461604.1 putative HNHc nuclease -
  P3T75_RS10980 (P3T75_10975) - 2270074..2271057 (-) 984 WP_282461605.1 DUF1351 domain-containing protein -
  P3T75_RS10985 (P3T75_10980) - 2271054..2271770 (-) 717 WP_282461606.1 ERF family protein -
  P3T75_RS10990 (P3T75_10985) - 2271844..2272362 (-) 519 WP_282461607.1 NUMOD4 domain-containing protein -
  P3T75_RS10995 (P3T75_10990) - 2272346..2272492 (-) 147 WP_282462619.1 hypothetical protein -
  P3T75_RS11000 (P3T75_10995) - 2272482..2273189 (-) 708 WP_282461608.1 Rha family transcriptional regulator -
  P3T75_RS11005 (P3T75_11000) - 2273295..2273483 (+) 189 WP_282461609.1 zinc ribbon domain-containing protein -
  P3T75_RS11010 (P3T75_11005) - 2273480..2273635 (-) 156 WP_282461610.1 hypothetical protein -
  P3T75_RS11015 (P3T75_11010) - 2273664..2273813 (-) 150 WP_282461611.1 hypothetical protein -
  P3T75_RS11020 (P3T75_11015) - 2273844..2274080 (-) 237 WP_282461612.1 helix-turn-helix domain-containing protein -
  P3T75_RS11025 (P3T75_11020) - 2274238..2274423 (+) 186 WP_282461613.1 hypothetical protein -
  P3T75_RS11030 (P3T75_11025) - 2274377..2274547 (-) 171 WP_282461614.1 hypothetical protein -
  P3T75_RS11035 (P3T75_11030) - 2274544..2274741 (-) 198 WP_282461615.1 helix-turn-helix transcriptional regulator -
  P3T75_RS11040 (P3T75_11035) - 2275126..2275314 (-) 189 WP_230711352.1 helix-turn-helix domain-containing protein -
  P3T75_RS11045 (P3T75_11040) - 2275590..2275928 (+) 339 WP_230711353.1 helix-turn-helix domain-containing protein -
  P3T75_RS11050 (P3T75_11045) - 2275932..2276369 (+) 438 WP_282461616.1 ImmA/IrrE family metallo-endopeptidase -
  P3T75_RS11055 (P3T75_11050) - 2276410..2276724 (+) 315 WP_282461617.1 hypothetical protein -
  P3T75_RS11060 (P3T75_11055) - 2276857..2278137 (+) 1281 WP_282461618.1 site-specific integrase -
  P3T75_RS11065 (P3T75_11060) - 2278344..2278589 (+) 246 WP_282461619.1 hypothetical protein -
  P3T75_RS11070 (P3T75_11065) upp 2278996..2279625 (-) 630 WP_173102291.1 uracil phosphoribosyltransferase -
  P3T75_RS11075 (P3T75_11070) - 2279686..2281311 (-) 1626 WP_282461620.1 ABC transporter -
  P3T75_RS11080 (P3T75_11075) - 2281298..2282056 (-) 759 WP_230710190.1 ABC transporter ATP-binding protein -
  P3T75_RS11085 (P3T75_11080) glyA 2282286..2283536 (-) 1251 WP_282461621.1 serine hydroxymethyltransferase -
  P3T75_RS11090 (P3T75_11085) - 2283669..2284700 (-) 1032 WP_282461622.1 L-threonylcarbamoyladenylate synthase -
  P3T75_RS11095 (P3T75_11090) prmC 2284901..2285734 (-) 834 WP_282461623.1 peptide chain release factor N(5)-glutamine methyltransferase -
  P3T75_RS11100 (P3T75_11095) prfA 2285727..2286800 (-) 1074 WP_206902314.1 peptide chain release factor 1 -
  P3T75_RS11105 (P3T75_11100) - 2286880..2287449 (-) 570 WP_206902313.1 thymidine kinase -
  P3T75_RS11110 (P3T75_11105) - 2287860..2289257 (+) 1398 WP_407649846.1 TrkH family potassium uptake protein -
  P3T75_RS11115 (P3T75_11110) - 2289627..2290979 (+) 1353 WP_206902311.1 Mur ligase family protein -

Sequence


Protein


Download         Length: 161 a.a.        Molecular weight: 18014.81 Da        Isoelectric Point: 5.1951

>NTDB_id=805753 P3T75_RS10965 WP_282461602.1 2268015..2268500(-) (ssbA) [Enterococcus montenegrensis strain CoE-012-22]
MINNVVLVGRLTKDPDLKYTGNGQAVATFTLAVNRNFTNQSGEREADFINCVIWRKPAETLANYARKGTLLGVTGRIQTR
NYENQQGQRVYVTEVVAENFQLLESKNSNSSQNTRDTDVSNNQTNNYTRNNQNASQMNLGVNPMNEFGATTIDINDDSLP
F

Nucleotide


Download         Length: 486 bp        

>NTDB_id=805753 P3T75_RS10965 WP_282461602.1 2268015..2268500(-) (ssbA) [Enterococcus montenegrensis strain CoE-012-22]
ATGATTAACAACGTAGTTCTAGTCGGGCGTCTAACTAAAGACCCTGACCTCAAATATACAGGAAACGGTCAAGCAGTCGC
GACCTTTACTTTAGCAGTAAATCGTAATTTCACGAACCAAAGCGGTGAGCGTGAAGCAGATTTTATCAATTGCGTAATCT
GGCGTAAACCAGCTGAAACTTTAGCAAATTATGCCCGCAAAGGAACGCTGCTAGGTGTTACCGGCCGTATTCAAACGCGG
AATTATGAAAATCAGCAAGGTCAGCGCGTATACGTGACAGAAGTTGTTGCGGAGAATTTTCAGTTGCTAGAAAGCAAGAA
TAGTAATTCTAGCCAAAATACACGCGATACAGACGTTTCGAATAATCAAACGAATAATTACACTCGAAACAACCAAAACG
CCTCCCAGATGAATTTAGGAGTAAATCCGATGAATGAATTTGGAGCTACGACAATCGACATCAATGATGATTCACTTCCG
TTTTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

57.803

100

0.621

  ssb Latilactobacillus sakei subsp. sakei 23K

55.556

100

0.59

  ssbB Bacillus subtilis subsp. subtilis str. 168

62.264

65.839

0.41

  ssbB/cilA Streptococcus pneumoniae TIGR4

54.717

65.839

0.36