Detailed information NTG0803714

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: P3U20_RS07070
• Genome accession: NZ_CP120146
• Coordinates: 1389767..1390084 (+)
• Length: 105 a.a.
• NCBI ID: WP_058611611.1
• Uniprot ID: -
• Organism: Mammaliicoccus sciuri strain Dog031
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1384767..1395084

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
P3U20_RS07030 (P3U20_07030)	-	1384912..1385103 (+)	192	WP_078099923.1	YqgQ family protein	-
P3U20_RS07035 (P3U20_07035)	-	1385100..1386071 (+)	972	WP_135016726.1	ROK family glucokinase	-
P3U20_RS07040 (P3U20_07040)	-	1386071..1386385 (+)	315	WP_058611614.1	MTH1187 family thiamine-binding protein	-
P3U20_RS07045 (P3U20_07045)	-	1386415..1386654 (-)	240	WP_016911885.1	DUF2759 domain-containing protein	-
P3U20_RS07050 (P3U20_07050)	-	1386752..1387384 (+)	633	WP_058611613.1	MBL fold metallo-hydrolase	-
P3U20_RS07055 (P3U20_07055)	-	1387418..1387666 (-)	249	WP_025904960.1	DUF2626 family protein	-
P3U20_RS07060 (P3U20_07060)	comGA	1387820..1388722 (+)	903	WP_323705693.1	competence type IV pilus ATPase ComGA	Machinery gene
P3U20_RS07065 (P3U20_07065)	comGB	1388712..1389752 (+)	1041	WP_077152202.1	competence type IV pilus assembly protein ComGB	-
P3U20_RS07070 (P3U20_07070)	comGC	1389767..1390084 (+)	318	WP_058611611.1	competence type IV pilus major pilin ComGC	Machinery gene
P3U20_RS07075 (P3U20_07075)	-	1390113..1390511 (+)	399	WP_049319406.1	hypothetical protein	-
P3U20_RS07080 (P3U20_07080)	-	1390495..1390776 (+)	282	WP_323705694.1	hypothetical protein	-
P3U20_RS07085 (P3U20_07085)	-	1390751..1391185 (+)	435	WP_323705695.1	competence type IV pilus minor pilin ComGF	-
P3U20_RS07090 (P3U20_07090)	-	1391420..1391908 (+)	489	WP_135016732.1	shikimate kinase	-
P3U20_RS07095 (P3U20_07095)	gcvT	1392101..1393189 (+)	1089	WP_058611608.1	glycine cleavage system aminomethyltransferase GcvT	-
P3U20_RS07100 (P3U20_07100)	gcvPA	1393201..1394544 (+)	1344	WP_323705696.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-

Sequence

Protein

• Length: 105 a.a.
• Molecular weight: 11605.67 Da
• Isoelectric Point: 8.5043

>NTDB_id=803714 P3U20_RS07070 WP_058611611.1 1389767..1390084(+) (comGC) [Mammaliicoccus sciuri strain Dog031]
MKRFKFLSKKEGFTLVEMLIVLLIISILLVIIIPNISKQSETVKSTGCQAQVKMVAGQVEAYTLKHDAKPNSINDLISDG
YINQKQLTCKSGETITLENGEVVAH

Nucleotide

• Length: 318 bp

>NTDB_id=803714 P3U20_RS07070 WP_058611611.1 1389767..1390084(+) (comGC) [Mammaliicoccus sciuri strain Dog031]
ATGAAAAGATTTAAATTTTTAAGTAAAAAAGAAGGGTTTACATTGGTTGAAATGTTAATTGTCCTTTTAATCATAAGTAT
ATTATTGGTGATCATCATACCAAACATCAGCAAGCAATCAGAGACGGTAAAAAGTACTGGATGCCAAGCACAAGTGAAAA
TGGTAGCTGGTCAAGTAGAAGCTTATACATTGAAACACGATGCTAAACCAAATTCTATAAATGATTTAATAAGTGATGGC
TATATTAACCAAAAGCAACTGACTTGTAAATCAGGAGAAACAATTACGCTAGAAAACGGTGAAGTTGTTGCACATTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (8-32)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus N315	65.686	97.143	0.638
comGC	Staphylococcus aureus MW2	65.686	97.143	0.638
comGC	Bacillus subtilis subsp. subtilis str. 168	47.312	88.571	0.419
comYC	Streptococcus mutans UA159	48.276	82.857	0.4
comYC	Streptococcus mutans UA140	48.276	82.857	0.4
comYC	Streptococcus gordonii str. Challis substr. CH1	47.674	81.905	0.39
comGC/cglC	Streptococcus mitis NCTC 12261	46.988	79.048	0.371
comGC/cglC	Streptococcus mitis SK321	46.988	79.048	0.371
comGC	Lactococcus lactis subsp. cremoris KW2	46.914	77.143	0.362
comYC	Streptococcus suis isolate S10	48.718	74.286	0.362