Detailed information NTG0800323

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: P3K38_RS06760
• Genome accession: NZ_CP119682
• Coordinates: 1441551..1441874 (-)
• Length: 107 a.a.
• NCBI ID: WP_015729165.1
• Uniprot ID: -
• Organism: Staphylococcus pseudintermedius strain CUVET18-1965
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1436551..1446874

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
P3K38_RS06730 (P3K38_06640)	gcvPA	1437135..1438484 (-)	1350	WP_014613828.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-
P3K38_RS06735 (P3K38_06645)	gcvT	1438497..1439588 (-)	1092	WP_015729161.1	glycine cleavage system aminomethyltransferase GcvT	-
P3K38_RS06740 (P3K38_06650)	-	1439746..1440273 (-)	528	WP_014613826.1	shikimate kinase	-
P3K38_RS06745	-	1440437..1440922 (-)	486	WP_080552896.1	prepilin-type N-terminal cleavage/methylation domain-containing protein	-
P3K38_RS06750 (P3K38_06660)	-	1440828..1441028 (-)	201	WP_020219623.1	hypothetical protein	-
P3K38_RS06755 (P3K38_06665)	comGD	1441133..1441573 (-)	441	WP_014613823.1	competence type IV pilus minor pilin ComGD	-
P3K38_RS06760 (P3K38_06670)	comGC	1441551..1441874 (-)	324	WP_015729165.1	competence type IV pilus major pilin ComGC	Machinery gene
P3K38_RS06765 (P3K38_06675)	comGB	1441887..1442954 (-)	1068	WP_014613821.1	competence type IV pilus assembly protein ComGB	-
P3K38_RS06770 (P3K38_06680)	comGA	1442923..1443897 (-)	975	WP_014613820.1	competence type IV pilus ATPase ComGA	Machinery gene
P3K38_RS06775 (P3K38_06685)	-	1444058..1444687 (-)	630	WP_096535719.1	MBL fold metallo-hydrolase	-
P3K38_RS06780 (P3K38_06690)	-	1444700..1445011 (-)	312	WP_014613818.1	MTH1187 family thiamine-binding protein	-
P3K38_RS06785 (P3K38_06695)	-	1445012..1445998 (-)	987	WP_065520488.1	ROK family glucokinase	-
P3K38_RS06790 (P3K38_06700)	-	1445995..1446198 (-)	204	WP_014613816.1	YqgQ family protein	-

Sequence

Protein

• Length: 107 a.a.
• Molecular weight: 12027.26 Da
• Isoelectric Point: 9.0966

>NTDB_id=800323 P3K38_RS06760 WP_015729165.1 1441551..1441874(-) (comGC) [Staphylococcus pseudintermedius strain CUVET18-1965]
MIQQLKLKFNKKKGFTLIEMLLVLLIISVLLILIIPNIAKQSDHIQKTGCAAQLKMVDSQIEAYALKFNHKPNTIDDLVR
EGYIKESQKTCKSGEEITIRDGEAVAS

Nucleotide

• Length: 324 bp

>NTDB_id=800323 P3K38_RS06760 WP_015729165.1 1441551..1441874(-) (comGC) [Staphylococcus pseudintermedius strain CUVET18-1965]
ATGATTCAACAACTTAAATTAAAATTCAACAAAAAGAAAGGTTTTACATTAATTGAAATGCTACTTGTTCTGTTAATTAT
TAGTGTACTATTGATTCTCATTATCCCGAATATTGCTAAGCAGTCAGATCATATCCAAAAAACGGGTTGTGCTGCACAAT
TAAAAATGGTCGATAGTCAAATAGAAGCCTATGCTTTAAAGTTTAACCACAAACCGAATACGATTGATGATTTAGTTCGT
GAAGGCTACATTAAAGAAAGTCAAAAAACATGCAAATCAGGTGAAGAGATCACAATCAGAGATGGCGAAGCAGTTGCGTC
ATGA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (10-34)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus MW2	73.529	95.327	0.701
comGC	Staphylococcus aureus N315	73.529	95.327	0.701
comGC/cglC	Streptococcus mitis SK321	44.898	91.589	0.411
comGC/cglC	Streptococcus pneumoniae D39	43.878	91.589	0.402
comGC/cglC	Streptococcus pneumoniae TIGR4	43.878	91.589	0.402
comGC/cglC	Streptococcus pneumoniae Rx1	43.878	91.589	0.402
comGC/cglC	Streptococcus pneumoniae R6	43.878	91.589	0.402
comYC	Streptococcus suis isolate S10	53.846	72.897	0.393
comYC	Streptococcus gordonii str. Challis substr. CH1	49.398	77.57	0.383
comGC	Bacillus subtilis subsp. subtilis str. 168	44.565	85.981	0.383
comGC/cglC	Streptococcus mitis NCTC 12261	48.78	76.636	0.374
comGC	Lactococcus lactis subsp. cremoris KW2	48.78	76.636	0.374