Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   P0Y37_RS10910 Genome accession   NZ_CP119523
Coordinates   2261226..2261678 (-) Length   150 a.a.
NCBI ID   WP_078801814.1    Uniprot ID   -
Organism   Pasteurella multocida strain LXSS001     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2249096..2307151 2261226..2261678 within 0


Gene organization within MGE regions


Location: 2249096..2307151
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  P0Y37_RS10815 metN 2249096..2250130 (-) 1035 WP_005718783.1 methionine ABC transporter ATP-binding protein MetN -
  P0Y37_RS10820 gmhB 2250323..2250877 (+) 555 WP_014668555.1 D-glycero-beta-D-manno-heptose 1,7-bisphosphate 7-phosphatase -
  P0Y37_RS10860 - 2256742..2257794 (-) 1053 WP_250010829.1 site-specific integrase -
  P0Y37_RS10865 - 2257704..2258036 (-) 333 WP_015691045.1 helix-turn-helix domain-containing protein -
  P0Y37_RS10870 - 2258164..2258607 (-) 444 WP_225529739.1 pyruvate kinase -
  P0Y37_RS10875 - 2258652..2259005 (-) 354 WP_041423219.1 hypothetical protein -
  P0Y37_RS10880 - 2259014..2259511 (-) 498 WP_014391445.1 DUF551 domain-containing protein -
  P0Y37_RS10885 - 2259523..2259759 (-) 237 WP_250010765.1 DUF551 domain-containing protein -
  P0Y37_RS10890 rdgC 2259743..2259862 (-) 120 Protein_2101 recombination-associated protein RdgC -
  P0Y37_RS10895 - 2259865..2260248 (-) 384 WP_250011022.1 hypothetical protein -
  P0Y37_RS10900 - 2260327..2260638 (-) 312 WP_014390701.1 DUF6378 domain-containing protein -
  P0Y37_RS10905 - 2260638..2261159 (-) 522 WP_014390702.1 MazG-like family protein -
  P0Y37_RS10910 ssb 2261226..2261678 (-) 453 WP_078801814.1 single-stranded DNA-binding protein Machinery gene
  P0Y37_RS10915 - 2261678..2262337 (-) 660 WP_041423209.1 translocation protein TolB precursor -
  P0Y37_RS10920 - 2262324..2263277 (-) 954 WP_014391451.1 recombinase RecT -
  P0Y37_RS10925 - 2263279..2263566 (-) 288 WP_014391452.1 hypothetical protein -
  P0Y37_RS10930 - 2263579..2263815 (-) 237 WP_078801815.1 hypothetical protein -
  P0Y37_RS10935 - 2263787..2264086 (-) 300 WP_014391453.1 hypothetical protein -
  P0Y37_RS10940 - 2264525..2265151 (-) 627 WP_078819688.1 Bro-N domain-containing protein -
  P0Y37_RS10945 - 2265565..2266362 (-) 798 WP_032854018.1 hypothetical protein -
  P0Y37_RS10950 - 2266449..2266712 (-) 264 WP_014391456.1 hypothetical protein -
  P0Y37_RS10955 - 2266896..2267168 (+) 273 WP_014391457.1 hypothetical protein -
  P0Y37_RS10960 - 2267161..2267349 (-) 189 WP_014391458.1 hypothetical protein -
  P0Y37_RS10965 - 2267887..2268168 (+) 282 WP_193628061.1 hypothetical protein -
  P0Y37_RS10970 - 2268421..2268621 (-) 201 WP_193628062.1 hypothetical protein -
  P0Y37_RS10975 - 2268883..2269197 (+) 315 WP_078819687.1 type II toxin-antitoxin system RelE/ParE family toxin -
  P0Y37_RS10980 - 2269194..2269484 (+) 291 WP_078819686.1 addiction module antidote protein -
  P0Y37_RS10985 - 2269510..2269914 (-) 405 WP_146024473.1 hypothetical protein -
  P0Y37_RS10990 - 2269944..2271788 (-) 1845 WP_071523830.1 DEAD/DEAH box helicase family protein -
  P0Y37_RS10995 - 2271999..2272676 (-) 678 WP_014390718.1 XRE family transcriptional regulator -
  P0Y37_RS11000 - 2272800..2272997 (+) 198 WP_014390719.1 helix-turn-helix domain-containing protein -
  P0Y37_RS11005 - 2273047..2273508 (+) 462 WP_078802159.1 phage regulatory CII family protein -
  P0Y37_RS11010 - 2273569..2274252 (+) 684 WP_078802160.1 phage antirepressor KilAC domain-containing protein -
  P0Y37_RS11015 - 2274249..2274464 (+) 216 WP_075271368.1 hypothetical protein -
  P0Y37_RS11020 - 2274461..2275240 (+) 780 WP_078819894.1 helix-turn-helix domain-containing protein -
  P0Y37_RS11025 - 2275237..2276592 (+) 1356 WP_078819893.1 replicative DNA helicase -
  P0Y37_RS11030 - 2276595..2277020 (+) 426 WP_078819892.1 recombination protein NinB -
  P0Y37_RS11035 - 2277094..2277309 (+) 216 WP_014667790.1 hypothetical protein -
  P0Y37_RS11040 - 2277302..2277904 (+) 603 WP_250058251.1 recombination protein NinG -
  P0Y37_RS11045 - 2277906..2278367 (+) 462 WP_241952116.1 antiterminator Q family protein -
  P0Y37_RS11050 - 2278493..2279056 (-) 564 WP_014667793.1 hypothetical protein -
  P0Y37_RS11055 - 2279174..2279434 (+) 261 WP_014391475.1 holin -
  P0Y37_RS11060 - 2279431..2279961 (+) 531 WP_014667794.1 lysozyme -
  P0Y37_RS11065 - 2279934..2280257 (+) 324 WP_014667795.1 DUF2570 family protein -
  P0Y37_RS11070 - 2280478..2280912 (-) 435 WP_046338366.1 type II toxin-antitoxin system HicB family antitoxin -
  P0Y37_RS11075 - 2280941..2281123 (-) 183 WP_016533497.1 type II toxin-antitoxin system HicA family toxin -
  P0Y37_RS11080 - 2281206..2281742 (+) 537 WP_078819878.1 terminase small subunit -
  P0Y37_RS11085 - 2281726..2282958 (+) 1233 WP_078819877.1 PBSX family phage terminase large subunit -
  P0Y37_RS11090 - 2282968..2284371 (+) 1404 WP_015691068.1 DUF4055 domain-containing protein -
  P0Y37_RS11095 - 2284361..2285962 (+) 1602 WP_078819879.1 minor capsid protein -
  P0Y37_RS11100 - 2285965..2286183 (+) 219 WP_078819876.1 hypothetical protein -
  P0Y37_RS11105 - 2286158..2286592 (+) 435 WP_015691071.1 HD domain-containing protein -
  P0Y37_RS11110 - 2286632..2286799 (+) 168 WP_016533111.1 hypothetical protein -
  P0Y37_RS11115 - 2286927..2287712 (+) 786 WP_064964916.1 hypothetical protein -
  P0Y37_RS11120 - 2287730..2288887 (+) 1158 WP_078819875.1 P22 phage major capsid protein family protein -
  P0Y37_RS11125 - 2288945..2289181 (+) 237 WP_078819874.1 HeH/LEM domain-containing protein -
  P0Y37_RS11130 - 2289198..2289665 (+) 468 WP_016533107.1 DnaT-like ssDNA-binding protein -
  P0Y37_RS11135 - 2289667..2290041 (+) 375 WP_015691077.1 hypothetical protein -
  P0Y37_RS11140 - 2290043..2290444 (+) 402 WP_016533105.1 HK97 gp10 family phage protein -
  P0Y37_RS11145 - 2290444..2290836 (+) 393 WP_015691079.1 phage tail terminator-like protein -
  P0Y37_RS11150 - 2290849..2291865 (+) 1017 WP_078819873.1 phage tail tube protein -
  P0Y37_RS11155 - 2291938..2292354 (+) 417 WP_078819872.1 hypothetical protein -
  P0Y37_RS11160 - 2292432..2292683 (+) 252 WP_202384037.1 hypothetical protein -
  P0Y37_RS11165 - 2292722..2293051 (+) 330 WP_078819870.1 phage tail protein -
  P0Y37_RS11170 - 2293123..2293818 (+) 696 WP_078819869.1 hypothetical protein -
  P0Y37_RS11175 - 2293940..2296654 (+) 2715 WP_275836927.1 tape measure protein -
  P0Y37_RS11180 - 2296651..2297355 (+) 705 WP_099803087.1 phage minor tail protein L -
  P0Y37_RS11185 - 2297358..2298098 (+) 741 WP_016570088.1 C40 family peptidase -
  P0Y37_RS11190 - 2298041..2298631 (+) 591 WP_042743292.1 tail assembly protein -
  P0Y37_RS11195 - 2298635..2304529 (+) 5895 WP_275836928.1 phage tail protein -
  P0Y37_RS11200 - 2304577..2304900 (+) 324 WP_014667801.1 hypothetical protein -
  P0Y37_RS11205 - 2305326..2306162 (+) 837 WP_014390712.1 KilA-N domain-containing protein -
  P0Y37_RS11210 - 2306465..2307151 (+) 687 WP_227486347.1 KilA-N domain-containing protein -

Sequence

Protein


Download         Length: 150 a.a.        Molecular weight: 17107.99 Da        Isoelectric Point: 7.9707

>NTDB_id=799502 P0Y37_RS10910 WP_078801814.1 2261226..2261678(-) (ssb) [Pasteurella multocida strain LXSS001]
MAGVNRVIILGNLGSDPEIRTMPNGDPVAKISVATSESWIDKNTNERKTQTEWHSIVFYRRQAEICGQYLKKGSKVYVEG
KLRTRKWQDQNGQDRYTTEIQGDVLQMLDSRQDSQQQQAQAPQNNAYANAKAGKPVQQQAYNFEEDNIPF

Nucleotide


Download         Length: 453 bp        

>NTDB_id=799502 P0Y37_RS10910 WP_078801814.1 2261226..2261678(-) (ssb) [Pasteurella multocida strain LXSS001]
ATGGCTGGGGTTAATCGTGTAATTATTTTAGGAAATTTAGGAAGCGATCCTGAAATCCGCACAATGCCAAATGGCGACCC
TGTGGCAAAAATCAGTGTGGCCACAAGTGAAAGCTGGATTGATAAAAACACAAACGAACGAAAAACACAAACTGAATGGC
ATTCTATCGTGTTCTATCGTCGCCAAGCAGAAATTTGCGGGCAGTATTTGAAGAAAGGCTCGAAAGTTTATGTGGAAGGT
AAGCTCAGAACACGCAAATGGCAAGATCAAAATGGTCAAGACCGCTACACCACAGAGATTCAAGGCGACGTATTACAAAT
GCTAGACAGTCGCCAAGATTCACAGCAACAGCAAGCACAGGCACCACAAAATAATGCTTATGCGAATGCGAAAGCTGGAA
AGCCTGTACAGCAACAAGCATATAACTTTGAAGAGGATAATATCCCATTCTGA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(4-108)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Glaesserella parasuis strain SC1401

60.556

100

0.727
  ssb Vibrio cholerae strain A1552

52.518

92.667

0.487
  ssb Neisseria gonorrhoeae MS11

44.526

91.333

0.407
  ssb Neisseria meningitidis MC58

44.526

91.333

0.407