Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   PU712_RS14145 Genome accession   NZ_CP118227
Coordinates   2989717..2990181 (+) Length   154 a.a.
NCBI ID   WP_274480572.1    Uniprot ID   -
Organism   Proteus mirabilis strain CY32     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2944670..2995845 2989717..2990181 within 0


Gene organization within MGE regions


Location: 2944670..2995845
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PU712_RS13795 (PU712_13795) - 2944670..2944900 (+) 231 WP_274480524.1 DNA polymerase III subunit theta -
  PU712_RS13800 (PU712_13800) - 2944905..2946434 (-) 1530 WP_274480525.1 hypothetical protein -
  PU712_RS13805 (PU712_13805) - 2946452..2950132 (-) 3681 WP_274480526.1 host specificity protein J -
  PU712_RS13810 (PU712_13810) - 2950132..2950698 (-) 567 WP_274480527.1 MoaD/ThiS family protein -
  PU712_RS13815 (PU712_13815) - 2950635..2951354 (-) 720 WP_274480529.1 C40 family peptidase -
  PU712_RS13820 (PU712_13820) - 2951358..2952056 (-) 699 WP_036971552.1 phage minor tail protein L -
  PU712_RS13825 (PU712_13825) - 2952053..2952382 (-) 330 WP_017628783.1 phage tail protein -
  PU712_RS13830 (PU712_13830) - 2952527..2952745 (+) 219 WP_217343357.1 hypothetical protein -
  PU712_RS13835 (PU712_13835) - 2952777..2952953 (-) 177 WP_217343358.1 hypothetical protein -
  PU712_RS13840 (PU712_13840) - 2952969..2956298 (-) 3330 WP_274480531.1 tape measure protein -
  PU712_RS13845 (PU712_13845) - 2956363..2956671 (-) 309 WP_124743686.1 hypothetical protein -
  PU712_RS13850 (PU712_13850) - 2956735..2957007 (-) 273 WP_064971344.1 hypothetical protein -
  PU712_RS13855 (PU712_13855) - 2957046..2957738 (-) 693 WP_121909508.1 hypothetical protein -
  PU712_RS13860 (PU712_13860) - 2957767..2958012 (-) 246 WP_121909506.1 Arc family DNA-binding protein -
  PU712_RS13865 (PU712_13865) - 2958109..2958261 (+) 153 WP_121909504.1 Arc family DNA-binding protein -
  PU712_RS13870 (PU712_13870) - 2958332..2959141 (+) 810 WP_223672958.1 phage antirepressor N-terminal domain-containing protein -
  PU712_RS13875 (PU712_13875) - 2959225..2959509 (-) 285 WP_274480533.1 type II toxin-antitoxin system HicA family toxin -
  PU712_RS13880 (PU712_13880) - 2959519..2959818 (-) 300 WP_161706816.1 type II toxin-antitoxin system HicB family antitoxin -
  PU712_RS13885 (PU712_13885) - 2960310..2961002 (-) 693 WP_121909261.1 DUF6246 family protein -
  PU712_RS13890 (PU712_13890) - 2961052..2961807 (-) 756 WP_274480534.1 Ig-like domain-containing protein -
  PU712_RS13895 (PU712_13895) - 2961871..2962239 (-) 369 WP_274480536.1 hypothetical protein -
  PU712_RS13900 (PU712_13900) - 2962236..2962604 (-) 369 WP_049257616.1 hypothetical protein -
  PU712_RS13905 (PU712_13905) - 2962606..2962947 (-) 342 WP_274480537.1 hypothetical protein -
  PU712_RS13910 (PU712_13910) - 2962947..2963345 (-) 399 WP_036905480.1 DUF7370 family protein -
  PU712_RS13915 (PU712_13915) - 2963402..2963575 (-) 174 WP_004247764.1 hypothetical protein -
  PU712_RS13920 (PU712_13920) - 2963585..2964679 (-) 1095 WP_240090857.1 major capsid protein -
  PU712_RS13925 (PU712_13925) - 2964695..2965141 (-) 447 WP_049257612.1 phage cement protein -
  PU712_RS13930 (PU712_13930) - 2965141..2966415 (-) 1275 WP_036905475.1 hypothetical protein -
  PU712_RS13935 (PU712_13935) - 2966419..2967348 (-) 930 WP_121909249.1 phage minor head protein -
  PU712_RS13940 (PU712_13940) - 2967299..2968654 (-) 1356 WP_121909247.1 anti-CBASS protein Acb1 family protein -
  PU712_RS13945 (PU712_13945) - 2968654..2969898 (-) 1245 WP_121909245.1 PBSX family phage terminase large subunit -
  PU712_RS13950 (PU712_13950) - 2969879..2970319 (-) 441 WP_004247756.1 hypothetical protein -
  PU712_RS13955 (PU712_13955) - 2970467..2970649 (-) 183 WP_004247755.1 hypothetical protein -
  PU712_RS13960 (PU712_13960) - 2970642..2970800 (-) 159 WP_274480538.1 hypothetical protein -
  PU712_RS13965 (PU712_13965) - 2970891..2971454 (-) 564 WP_181880499.1 Rha family transcriptional regulator -
  PU712_RS13970 (PU712_13970) - 2971706..2972089 (-) 384 WP_274480539.1 Gp49 family protein -
  PU712_RS19580 lysC 2972203..2972457 (-) 255 WP_420801558.1 Rz1-like lysis system protein LysC -
  PU712_RS13975 (PU712_13975) - 2972345..2972725 (-) 381 WP_274480540.1 hypothetical protein -
  PU712_RS13980 (PU712_13980) - 2972722..2973126 (-) 405 WP_143475400.1 structural protein -
  PU712_RS13985 (PU712_13985) - 2973123..2973428 (-) 306 WP_049199107.1 phage holin family protein -
  PU712_RS13995 (PU712_13995) - 2973954..2974568 (-) 615 WP_109937974.1 DUF1133 family protein -
  PU712_RS14000 (PU712_14000) - 2974565..2974756 (-) 192 WP_063693385.1 hypothetical protein -
  PU712_RS14005 (PU712_14005) - 2974756..2975376 (-) 621 WP_149127665.1 recombination protein NinG -
  PU712_RS14010 (PU712_14010) - 2975488..2976150 (-) 663 WP_274480549.1 metallophosphoesterase -
  PU712_RS14015 (PU712_14015) - 2976147..2976359 (-) 213 WP_274480550.1 hypothetical protein -
  PU712_RS14020 (PU712_14020) - 2976362..2976568 (-) 207 Protein_2719 repressor LexA -
  PU712_RS14025 (PU712_14025) - 2976565..2976708 (-) 144 WP_274480551.1 hypothetical protein -
  PU712_RS14030 (PU712_14030) - 2976701..2976931 (-) 231 WP_105874342.1 DUF3310 domain-containing protein -
  PU712_RS14035 (PU712_14035) - 2976937..2977383 (-) 447 WP_060556910.1 recombination protein NinB -
  PU712_RS14040 (PU712_14040) - 2977915..2978139 (-) 225 WP_060556611.1 DUF551 domain-containing protein -
  PU712_RS14045 (PU712_14045) - 2978139..2978348 (-) 210 WP_274480552.1 MarR family transcriptional regulator -
  PU712_RS14050 (PU712_14050) - 2978535..2979902 (-) 1368 WP_274480988.1 replicative DNA helicase -
  PU712_RS14055 (PU712_14055) - 2979906..2980742 (-) 837 WP_129037626.1 replication protein -
  PU712_RS14060 (PU712_14060) - 2981020..2981346 (-) 327 WP_049220837.1 CII family transcriptional regulator -
  PU712_RS14065 (PU712_14065) - 2981548..2981775 (-) 228 WP_063693416.1 transcriptional regulator -
  PU712_RS14070 (PU712_14070) - 2981884..2982582 (+) 699 WP_063693278.1 S24 family peptidase -
  PU712_RS14075 (PU712_14075) - 2982617..2982958 (+) 342 WP_004245991.1 DUF3024 domain-containing protein -
  PU712_RS14080 (PU712_14080) - 2983470..2984033 (+) 564 WP_175215961.1 type II toxin-antitoxin system MqsA family antitoxin -
  PU712_RS14085 (PU712_14085) - 2984035..2984436 (+) 402 WP_062814394.1 protein-export chaperone SecB -
  PU712_RS14090 (PU712_14090) - 2984765..2985337 (+) 573 WP_274480561.1 HNH endonuclease -
  PU712_RS14095 (PU712_14095) - 2985352..2985504 (+) 153 WP_004247470.1 hypothetical protein -
  PU712_RS14100 (PU712_14100) - 2985501..2985686 (-) 186 WP_004247469.1 hypothetical protein -
  PU712_RS14105 (PU712_14105) - 2985900..2986139 (+) 240 WP_274480564.1 hypothetical protein -
  PU712_RS14110 (PU712_14110) - 2986141..2986440 (+) 300 WP_124725252.1 hypothetical protein -
  PU712_RS14115 (PU712_14115) - 2986523..2987464 (+) 942 WP_274480566.1 cell envelope biogenesis protein TolA -
  PU712_RS14120 (PU712_14120) - 2987687..2987962 (+) 276 WP_058336156.1 hypothetical protein -
  PU712_RS14125 (PU712_14125) - 2987959..2988111 (+) 153 WP_175212394.1 hypothetical protein -
  PU712_RS14130 (PU712_14130) - 2988108..2988428 (+) 321 WP_060558097.1 hypothetical protein -
  PU712_RS14135 (PU712_14135) exoX 2988430..2989107 (+) 678 WP_060558095.1 exodeoxyribonuclease X -
  PU712_RS14140 (PU712_14140) - 2989100..2989717 (+) 618 WP_060558093.1 ERF family protein -
  PU712_RS14145 (PU712_14145) ssb 2989717..2990181 (+) 465 WP_274480572.1 single-stranded DNA-binding protein Machinery gene
  PU712_RS14150 (PU712_14150) - 2990239..2990397 (+) 159 WP_105881171.1 hook protein -
  PU712_RS14155 (PU712_14155) - 2990507..2990800 (+) 294 WP_274480575.1 hypothetical protein -
  PU712_RS14160 (PU712_14160) - 2990800..2990958 (+) 159 WP_158660332.1 hypothetical protein -
  PU712_RS14165 (PU712_14165) - 2991112..2991285 (+) 174 WP_167652470.1 hypothetical protein -
  PU712_RS14170 (PU712_14170) - 2991435..2991647 (+) 213 WP_274480577.1 hypothetical protein -
  PU712_RS14175 (PU712_14175) - 2991634..2992236 (+) 603 WP_274480578.1 MT-A70 family methyltransferase -
  PU712_RS14180 (PU712_14180) - 2992351..2992509 (-) 159 WP_209036325.1 hypothetical protein -
  PU712_RS14185 (PU712_14185) - 2992672..2993829 (+) 1158 WP_049206334.1 tyrosine-type recombinase/integrase -
  PU712_RS14195 (PU712_14195) folD 2994118..2994990 (+) 873 WP_060554830.1 bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD -
  PU712_RS14200 (PU712_14200) ybcJ 2994994..2995206 (+) 213 WP_046334705.1 ribosome-associated protein YbcJ -

Sequence

Protein


Download         Length: 154 a.a.        Molecular weight: 17030.97 Da        Isoelectric Point: 5.2248

>NTDB_id=791142 PU712_RS14145 WP_274480572.1 2989717..2990181(+) (ssb) [Proteus mirabilis strain CY32]
MASKGVNKCILIGHLGQDPEIRYMPSGGAVANLTLATSESWRDKQTGEMKEKTEWHRVCIFGKLAEIAGEYLRKGSQVYI
EGSLQTRKWQDQSGQDRYTTEVVVNVGGSMQMLGGNGGNQAGSQKTQNQGWGQPQQPATQNEPPMDWDDQEIPF

Nucleotide


Download         Length: 465 bp        

>NTDB_id=791142 PU712_RS14145 WP_274480572.1 2989717..2990181(+) (ssb) [Proteus mirabilis strain CY32]
ATGGCAAGTAAAGGCGTGAATAAATGTATTCTTATTGGTCACTTGGGGCAGGATCCAGAAATCCGCTATATGCCATCAGG
TGGCGCAGTAGCAAACCTCACACTAGCCACATCGGAATCGTGGCGTGATAAACAAACCGGTGAGATGAAAGAAAAAACCG
AGTGGCATCGAGTGTGCATCTTCGGCAAATTAGCAGAAATTGCAGGTGAATATCTGAGAAAAGGAAGTCAAGTATATATC
GAAGGTTCTCTGCAAACCAGAAAATGGCAAGACCAAAGCGGGCAAGACCGATACACAACGGAAGTGGTAGTTAATGTCGG
CGGTTCTATGCAGATGTTAGGCGGTAACGGTGGTAATCAGGCAGGAAGCCAGAAGACACAAAACCAAGGATGGGGGCAAC
CACAACAACCAGCTACGCAGAATGAGCCGCCGATGGATTGGGATGACCAAGAAATACCCTTCTAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(6-112)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Vibrio cholerae strain A1552

68.539

100

0.792
  ssb Glaesserella parasuis strain SC1401

53.039

100

0.623
  ssb Neisseria gonorrhoeae MS11

48.252

92.857

0.448
  ssb Neisseria meningitidis MC58

48.252

92.857

0.448