Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | PUV55_RS00685 | Genome accession | NZ_CP118165 |
| Coordinates | 148328..148816 (+) | Length | 162 a.a. |
| NCBI ID | WP_021112584.1 | Uniprot ID | A0A084EF36 |
| Organism | Glaesserella parasuis strain XP11 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 140352..208808 | 148328..148816 | within | 0 |
Gene organization within MGE regions
Location: 140352..208808
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PUV55_RS00650 (PUV55_00650) | - | 140467..141285 (+) | 819 | WP_021112517.1 | ParA family protein | - |
| PUV55_RS00655 (PUV55_00655) | dnaB | 141298..142689 (+) | 1392 | WP_021112585.1 | replicative DNA helicase | - |
| PUV55_RS00660 (PUV55_00660) | - | 142682..144430 (+) | 1749 | WP_021112550.1 | ParB family protein | - |
| PUV55_RS00665 (PUV55_00665) | - | 144432..144992 (+) | 561 | WP_021112531.1 | DUF2857 domain-containing protein | - |
| PUV55_RS00670 (PUV55_00670) | - | 145062..146333 (+) | 1272 | WP_021112592.1 | STY4528 family pathogenicity island replication protein | - |
| PUV55_RS00675 (PUV55_00675) | - | 146791..147531 (+) | 741 | WP_021112564.1 | PFL_4669 family integrating conjugative element protein | - |
| PUV55_RS00680 (PUV55_00680) | - | 147536..148015 (+) | 480 | WP_021112594.1 | DUF3158 family protein | - |
| PUV55_RS00685 (PUV55_00685) | ssb | 148328..148816 (+) | 489 | WP_021112584.1 | single-stranded DNA-binding protein | Machinery gene |
| PUV55_RS00690 (PUV55_00690) | - | 148913..149392 (+) | 480 | WP_021112590.1 | hypothetical protein | - |
| PUV55_RS00695 (PUV55_00695) | - | 149622..151649 (+) | 2028 | WP_021112534.1 | DNA topoisomerase III | - |
| PUV55_RS00700 (PUV55_00700) | - | 152506..152943 (+) | 438 | WP_021112535.1 | STY4534 family ICE replication protein | - |
| PUV55_RS00705 (PUV55_00705) | - | 152992..153309 (+) | 318 | WP_274359605.1 | hypothetical protein | - |
| PUV55_RS00710 (PUV55_00710) | - | 153408..153737 (+) | 330 | WP_021112552.1 | hypothetical protein | - |
| PUV55_RS00715 (PUV55_00715) | - | 153817..154464 (+) | 648 | WP_021112518.1 | DUF3560 domain-containing protein | - |
| PUV55_RS00720 (PUV55_00720) | radC | 154539..155024 (+) | 486 | WP_021112539.1 | RadC family protein | - |
| PUV55_RS00725 (PUV55_00725) | - | 155176..155844 (+) | 669 | WP_042906592.1 | hypothetical protein | - |
| PUV55_RS00730 (PUV55_00730) | - | 155938..156690 (+) | 753 | WP_021112582.1 | TIGR03759 family integrating conjugative element protein | - |
| PUV55_RS00735 (PUV55_00735) | - | 156669..157394 (+) | 726 | WP_021112547.1 | murein transglycosylase | - |
| PUV55_RS00740 (PUV55_00740) | - | 157391..157900 (+) | 510 | WP_021112528.1 | integrating conjugative element protein | - |
| PUV55_RS00745 (PUV55_00745) | traD | 157897..160068 (+) | 2172 | WP_207342642.1 | type IV conjugative transfer system coupling protein TraD | - |
| PUV55_RS00750 (PUV55_00750) | - | 160037..160375 (+) | 339 | WP_021112530.1 | hypothetical protein | - |
| PUV55_RS00755 (PUV55_00755) | - | 160375..161070 (+) | 696 | WP_021112543.1 | TIGR03747 family integrating conjugative element membrane protein | - |
| PUV55_RS00760 (PUV55_00760) | - | 161231..161554 (+) | 324 | WP_021112558.1 | RAQPRD family integrative conjugative element protein | - |
| PUV55_RS12420 | - | 161551..161784 (+) | 234 | WP_042905578.1 | DUF3262 family protein | - |
| PUV55_RS00765 (PUV55_00765) | - | 161814..162188 (+) | 375 | WP_021112521.1 | TIGR03745 family integrating conjugative element membrane protein | - |
| PUV55_RS00770 (PUV55_00770) | - | 162199..162573 (+) | 375 | WP_021112591.1 | TIGR03750 family conjugal transfer protein | - |
| PUV55_RS00775 (PUV55_00775) | - | 162570..163208 (+) | 639 | WP_021112553.1 | PFL_4703 family integrating conjugative element protein | - |
| PUV55_RS00780 (PUV55_00780) | - | 163228..164070 (+) | 843 | WP_042905584.1 | TIGR03749 family integrating conjugative element protein | - |
| PUV55_RS00785 (PUV55_00785) | - | 164080..165519 (+) | 1440 | WP_021112571.1 | TIGR03752 family integrating conjugative element protein | - |
| PUV55_RS00790 (PUV55_00790) | - | 165530..165937 (+) | 408 | WP_021112563.1 | TIGR03751 family conjugal transfer lipoprotein | - |
| PUV55_RS00795 (PUV55_00795) | - | 165956..168775 (+) | 2820 | WP_021112560.1 | conjugative transfer ATPase | - |
| PUV55_RS00800 (PUV55_00800) | - | 168772..168936 (+) | 165 | WP_160415286.1 | hypothetical protein | - |
| PUV55_RS00805 (PUV55_00805) | - | 168927..169898 (-) | 972 | WP_016528180.1 | IS110 family transposase | - |
| PUV55_RS00810 (PUV55_00810) | - | 170168..170344 (+) | 177 | WP_160416817.1 | hypothetical protein | - |
| PUV55_RS00815 (PUV55_00815) | - | 170371..170718 (+) | 348 | WP_021112583.1 | hypothetical protein | - |
| PUV55_RS00820 (PUV55_00820) | - | 170723..172198 (+) | 1476 | WP_021112587.1 | conjugal transfer protein TraG N-terminal domain-containing protein | - |
| PUV55_RS00825 (PUV55_00825) | - | 172441..172890 (-) | 450 | WP_021112573.1 | hypothetical protein | - |
| PUV55_RS00830 (PUV55_00830) | - | 172912..174879 (-) | 1968 | WP_021112554.1 | integrating conjugative element protein | - |
| PUV55_RS00835 (PUV55_00835) | - | 174888..175859 (-) | 972 | WP_043895478.1 | TIGR03756 family integrating conjugative element protein | - |
| PUV55_RS00840 (PUV55_00840) | - | 175869..176291 (-) | 423 | WP_021112581.1 | TIGR03757 family integrating conjugative element protein | - |
| PUV55_RS00845 (PUV55_00845) | - | 176686..177024 (+) | 339 | WP_021112514.1 | hypothetical protein | - |
| PUV55_RS00850 (PUV55_00850) | - | 177471..178442 (+) | 972 | WP_021112562.1 | ArdC family protein | - |
| PUV55_RS00855 (PUV55_00855) | - | 178453..178683 (+) | 231 | WP_042905579.1 | hypothetical protein | - |
| PUV55_RS00860 (PUV55_00860) | - | 178805..179536 (+) | 732 | WP_021112532.1 | hypothetical protein | - |
| PUV55_RS00865 (PUV55_00865) | - | 179678..180019 (-) | 342 | WP_021112541.1 | hypothetical protein | - |
| PUV55_RS00870 (PUV55_00870) | - | 180099..180752 (-) | 654 | WP_021112555.1 | recombinase family protein | - |
| PUV55_RS00875 (PUV55_00875) | - | 181038..181349 (+) | 312 | WP_052157437.1 | hypothetical protein | - |
| PUV55_RS00880 (PUV55_00880) | - | 181539..182117 (+) | 579 | WP_021112589.1 | hypothetical protein | - |
| PUV55_RS00885 (PUV55_00885) | - | 182347..182610 (-) | 264 | WP_042905580.1 | hypothetical protein | - |
| PUV55_RS00890 (PUV55_00890) | - | 182642..183532 (-) | 891 | WP_416118546.1 | IS256 family transposase, variant Zn-binding type | - |
| PUV55_RS00895 (PUV55_00895) | - | 183657..185027 (-) | 1371 | WP_075605835.1 | RHS repeat protein | - |
| PUV55_RS00900 (PUV55_00900) | - | 185164..186372 (+) | 1209 | WP_021112574.1 | IS4-like element ISVsa5 family transposase | - |
| PUV55_RS12425 | - | 186382..186507 (-) | 126 | WP_001303004.1 | LysR family transcriptional regulator | - |
| PUV55_RS00905 (PUV55_00905) | gltS | 186738..187943 (-) | 1206 | WP_000599533.1 | sodium/glutamate symporter | - |
| PUV55_RS00910 (PUV55_00910) | - | 188387..188707 (+) | 321 | WP_000562370.1 | antibiotic biosynthesis monooxygenase family protein | - |
| PUV55_RS00915 (PUV55_00915) | - | 188700..189086 (+) | 387 | Protein_177 | amino acid-binding protein | - |
| PUV55_RS00920 (PUV55_00920) | - | 189094..189780 (+) | 687 | WP_001284954.1 | ArsR/SmtB family transcription factor | - |
| PUV55_RS00925 (PUV55_00925) | tetR(B) | 189758..190381 (-) | 624 | WP_000088605.1 | tetracycline resistance transcriptional repressor TetR(B) | - |
| PUV55_RS00930 (PUV55_00930) | tet(B) | 190463..191668 (+) | 1206 | WP_274359716.1 | tetracycline efflux MFS transporter Tet(B) | - |
| PUV55_RS00935 (PUV55_00935) | - | 191830..192804 (+) | 975 | WP_012478345.1 | IS30-like element ISApl1 family transposase | - |
| PUV55_RS00940 (PUV55_00940) | - | 193537..194436 (-) | 900 | WP_021112548.1 | tyrosine-type recombinase/integrase | - |
| PUV55_RS00945 (PUV55_00945) | - | 194598..195032 (+) | 435 | WP_042905715.1 | DNA-binding protein | - |
| PUV55_RS00950 (PUV55_00950) | - | 195022..195333 (-) | 312 | WP_052157455.1 | helix-turn-helix domain-containing protein | - |
| PUV55_RS00955 (PUV55_00955) | - | 195665..196639 (-) | 975 | WP_012478345.1 | IS30-like element ISApl1 family transposase | - |
| PUV55_RS00960 (PUV55_00960) | - | 196820..197830 (-) | 1011 | WP_021112546.1 | hypothetical protein | - |
| PUV55_RS00965 (PUV55_00965) | - | 197871..198593 (+) | 723 | WP_021112540.1 | C45 family autoproteolytic acyltransferase/hydolase | - |
| PUV55_RS00970 (PUV55_00970) | - | 198747..199562 (-) | 816 | WP_053273111.1 | APH(3')-I family aminoglycoside O-phosphotransferase | - |
| PUV55_RS00975 (PUV55_00975) | - | 199699..199800 (+) | 102 | Protein_189 | IS5/IS1182 family transposase | - |
| PUV55_RS00980 (PUV55_00980) | - | 199898..200734 (-) | 837 | WP_000480968.1 | aminoglycoside O-phosphotransferase APH(6)-Id | - |
| PUV55_RS00985 (PUV55_00985) | - | 200734..201408 (-) | 675 | Protein_191 | APH(3'') family aminoglycoside O-phosphotransferase | - |
| PUV55_RS00990 (PUV55_00990) | - | 201333..201560 (-) | 228 | WP_274359772.1 | helix-turn-helix domain-containing protein | - |
| PUV55_RS00995 (PUV55_00995) | floR | 201588..202802 (-) | 1215 | WP_023300759.1 | chloramphenicol/florfenicol efflux MFS transporter FloR | - |
| PUV55_RS01000 (PUV55_01000) | - | 203020..203418 (-) | 399 | Protein_194 | aminoglycoside phosphotransferase family protein | - |
| PUV55_RS01005 (PUV55_01005) | aph(3'')-Ib | 203418..204221 (-) | 804 | WP_001082319.1 | aminoglycoside O-phosphotransferase APH(3'')-Ib | - |
| PUV55_RS01010 (PUV55_01010) | sul2 | 204208..205059 (-) | 852 | WP_011270145.1 | sulfonamide-resistant dihydropteroate synthase Sul2 | - |
| PUV55_RS01015 (PUV55_01015) | - | 205268..205489 (-) | 222 | Protein_197 | helix-turn-helix domain-containing protein | - |
| PUV55_RS01020 (PUV55_01020) | mobH | 205625..207550 (+) | 1926 | WP_021112557.1 | MobH family relaxase | - |
| PUV55_RS01025 (PUV55_01025) | - | 207578..208444 (+) | 867 | WP_021112578.1 | tyrosine-type recombinase/integrase | - |
Sequence
Protein
Download Length: 162 a.a. Molecular weight: 18346.53 Da Isoelectric Point: 6.7622
>NTDB_id=790895 PUV55_RS00685 WP_021112584.1 148328..148816(+) (ssb) [Glaesserella parasuis strain XP11]
MSGVNKVTIIGNLGTDPDVRTMPNGDAVTTLSVATSDVWNDKNTGERKEVTEWHRIVLFRRQAEVAGQYLHKGSKVYIEG
KLKTRKWQDQNGVDRYTTEIWASELQMLDSKPSNFPPPLGESQTKSQQKHSPQPEPPMDNFDDDIPFSPIHHGFSKHSIY
VI
MSGVNKVTIIGNLGTDPDVRTMPNGDAVTTLSVATSDVWNDKNTGERKEVTEWHRIVLFRRQAEVAGQYLHKGSKVYIEG
KLKTRKWQDQNGVDRYTTEIWASELQMLDSKPSNFPPPLGESQTKSQQKHSPQPEPPMDNFDDDIPFSPIHHGFSKHSIY
VI
Nucleotide
Download Length: 489 bp
>NTDB_id=790895 PUV55_RS00685 WP_021112584.1 148328..148816(+) (ssb) [Glaesserella parasuis strain XP11]
ATGTCTGGCGTGAATAAGGTCACAATTATTGGTAATCTTGGTACAGATCCTGATGTTCGTACTATGCCTAATGGTGATGC
TGTAACAACACTCAGTGTTGCTACAAGTGATGTGTGGAATGATAAGAATACGGGGGAACGGAAAGAAGTCACTGAATGGC
ACCGTATTGTATTATTTCGCCGTCAAGCTGAAGTGGCAGGGCAATACTTACATAAAGGTTCGAAAGTATACATTGAAGGA
AAATTGAAAACACGCAAATGGCAAGATCAAAATGGTGTCGATCGCTATACCACAGAAATTTGGGCTTCTGAGTTACAGAT
GTTAGACAGTAAACCAAGCAATTTTCCACCACCTTTAGGTGAGTCGCAGACAAAATCTCAACAAAAACACTCTCCACAAC
CTGAACCACCGATGGATAATTTCGATGATGATATTCCATTTTCTCCAATTCACCACGGTTTTAGCAAACATTCTATTTAT
GTAATTTAA
ATGTCTGGCGTGAATAAGGTCACAATTATTGGTAATCTTGGTACAGATCCTGATGTTCGTACTATGCCTAATGGTGATGC
TGTAACAACACTCAGTGTTGCTACAAGTGATGTGTGGAATGATAAGAATACGGGGGAACGGAAAGAAGTCACTGAATGGC
ACCGTATTGTATTATTTCGCCGTCAAGCTGAAGTGGCAGGGCAATACTTACATAAAGGTTCGAAAGTATACATTGAAGGA
AAATTGAAAACACGCAAATGGCAAGATCAAAATGGTGTCGATCGCTATACCACAGAAATTTGGGCTTCTGAGTTACAGAT
GTTAGACAGTAAACCAAGCAATTTTCCACCACCTTTAGGTGAGTCGCAGACAAAATCTCAACAAAAACACTCTCCACAAC
CTGAACCACCGATGGATAATTTCGATGATGATATTCCATTTTCTCCAATTCACCACGGTTTTAGCAAACATTCTATTTAT
GTAATTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Glaesserella parasuis strain SC1401 |
63.333 |
100 |
0.704 |
| ssb | Vibrio cholerae strain A1552 |
50.575 |
100 |
0.543 |
| ssb | Neisseria meningitidis MC58 |
43.353 |
100 |
0.463 |
| ssb | Neisseria gonorrhoeae MS11 |
42.775 |
100 |
0.457 |