Detailed information
Bioinformatically predicted
Overview
| Name | ideA | Type | Regulator |
| Locus tag | PUN50_RS03530 | Genome accession | NZ_CP117988 |
| Coordinates | 751088..751765 (-) | Length | 225 a.a. |
| NCBI ID | WP_140587199.1 | Uniprot ID | A0A501X3F5 |
| Organism | Vibrio campbellii strain 20220413_1 | ||
| Function | repress natural transformation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 704190..774713 | 751088..751765 | within | 0 |
Gene organization within MGE regions
Location: 704190..774713
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PUN50_RS03335 (PUN50_03335) | - | 704190..705431 (-) | 1242 | WP_028870222.1 | tyrosine-type recombinase/integrase | - |
| PUN50_RS03340 (PUN50_03340) | - | 705433..705702 (-) | 270 | WP_032479292.1 | hypothetical protein | - |
| PUN50_RS03345 (PUN50_03345) | - | 705705..706679 (-) | 975 | WP_001963822.1 | ParM/StbA family protein | - |
| PUN50_RS03350 (PUN50_03350) | mobI | 707144..707587 (+) | 444 | WP_045613981.1 | conjugative transfer protein MobI(A/C) | - |
| PUN50_RS03355 (PUN50_03355) | umuC | 707598..708905 (-) | 1308 | WP_274290859.1 | translesion error-prone DNA polymerase V subunit UmuC | - |
| PUN50_RS03360 (PUN50_03360) | umuD | 708874..709323 (-) | 450 | WP_005394623.1 | translesion error-prone DNA polymerase V autoproteolytic subunit | - |
| PUN50_RS03365 (PUN50_03365) | - | 709979..710884 (+) | 906 | WP_274290860.1 | 3'-5' exonuclease | - |
| PUN50_RS03370 (PUN50_03370) | - | 711098..711397 (+) | 300 | WP_274290861.1 | hypothetical protein | - |
| PUN50_RS03375 (PUN50_03375) | - | 711716..712651 (+) | 936 | WP_274290862.1 | WYL domain-containing protein | - |
| PUN50_RS03380 (PUN50_03380) | - | 712689..716021 (+) | 3333 | WP_274290863.1 | helicase-related protein | - |
| PUN50_RS03385 (PUN50_03385) | - | 716025..716711 (+) | 687 | WP_274290864.1 | DUF4391 domain-containing protein | - |
| PUN50_RS03390 (PUN50_03390) | - | 716785..718677 (+) | 1893 | WP_274290865.1 | site-specific DNA-methyltransferase | - |
| PUN50_RS03395 (PUN50_03395) | - | 718687..721764 (+) | 3078 | WP_274290866.1 | type III restriction-modification system endonuclease | - |
| PUN50_RS03400 (PUN50_03400) | - | 721872..722717 (+) | 846 | WP_274290867.1 | hypothetical protein | - |
| PUN50_RS03405 (PUN50_03405) | mobH | 722980..725130 (+) | 2151 | WP_274290868.1 | MobH family relaxase | - |
| PUN50_RS03410 (PUN50_03410) | traD | 725179..726999 (+) | 1821 | WP_008844777.1 | conjugative transfer system coupling protein TraD | - |
| PUN50_RS03415 (PUN50_03415) | - | 727009..727569 (+) | 561 | WP_149151580.1 | conjugative transfer protein | - |
| PUN50_RS03420 (PUN50_03420) | - | 727556..728191 (+) | 636 | WP_274290869.1 | DUF4400 domain-containing protein | - |
| PUN50_RS03425 (PUN50_03425) | - | 728217..728495 (-) | 279 | WP_000058216.1 | helix-turn-helix domain-containing protein | - |
| PUN50_RS03430 (PUN50_03430) | - | 728492..728815 (-) | 324 | WP_001896384.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| PUN50_RS03435 (PUN50_03435) | traL | 728996..729277 (+) | 282 | WP_000433891.1 | type IV conjugative transfer system protein TraL | - |
| PUN50_RS03440 (PUN50_03440) | - | 729274..729900 (+) | 627 | WP_274290870.1 | TraE/TraK family type IV conjugative transfer system protein | - |
| PUN50_RS03445 (PUN50_03445) | - | 729884..730780 (+) | 897 | WP_274291235.1 | TraK domain-containing protein | - |
| PUN50_RS03450 (PUN50_03450) | - | 730783..732072 (+) | 1290 | WP_274290871.1 | TraB/VirB10 family protein | - |
| PUN50_RS03455 (PUN50_03455) | traV | 732147..732719 (+) | 573 | WP_024008834.1 | type IV conjugative transfer system lipoprotein TraV | - |
| PUN50_RS03460 (PUN50_03460) | traA | 732716..733102 (+) | 387 | WP_023584042.1 | TraA family conjugative transfer protein | - |
| PUN50_RS03465 (PUN50_03465) | - | 733143..733649 (-) | 507 | WP_274290872.1 | GNAT family N-acetyltransferase | - |
| PUN50_RS03470 (PUN50_03470) | - | 733640..733906 (-) | 267 | WP_000212004.1 | DUF1778 domain-containing protein | - |
| PUN50_RS03475 (PUN50_03475) | - | 734275..734967 (+) | 693 | WP_274290873.1 | DsbC family protein | - |
| PUN50_RS03480 (PUN50_03480) | traC | 734967..737366 (+) | 2400 | WP_193284099.1 | type IV secretion system protein TraC | - |
| PUN50_RS03485 (PUN50_03485) | - | 737359..737706 (+) | 348 | WP_015066569.1 | hypothetical protein | - |
| PUN50_RS03490 (PUN50_03490) | - | 737690..738202 (+) | 513 | WP_258519357.1 | S26 family signal peptidase | - |
| PUN50_RS03495 (PUN50_03495) | - | 738213..739337 (+) | 1125 | WP_274291236.1 | TrbC family F-type conjugative pilus assembly protein | - |
| PUN50_RS03500 (PUN50_03500) | - | 739321..740349 (+) | 1029 | WP_274290874.1 | TraU family protein | - |
| PUN50_RS03505 (PUN50_03505) | traN | 740352..744044 (+) | 3693 | WP_274290875.1 | conjugal transfer protein TraN | - |
| PUN50_RS03510 (PUN50_03510) | - | 744251..744427 (-) | 177 | WP_206975078.1 | transposase | - |
| PUN50_RS03515 (PUN50_03515) | - | 744688..745653 (+) | 966 | WP_219845879.1 | DNA-processing protein DprA | - |
| PUN50_RS03520 (PUN50_03520) | - | 745650..750326 (+) | 4677 | WP_140587201.1 | RecQ family ATP-dependent DNA helicase | - |
| PUN50_RS03525 (PUN50_03525) | - | 750323..750811 (+) | 489 | WP_140587200.1 | hypothetical protein | - |
| PUN50_RS03530 (PUN50_03530) | ideA | 751088..751765 (-) | 678 | WP_140587199.1 | endonuclease | Regulator |
| PUN50_RS03535 (PUN50_03535) | - | 751874..752476 (-) | 603 | WP_140587198.1 | hypothetical protein | - |
| PUN50_RS03540 (PUN50_03540) | - | 752843..753169 (+) | 327 | WP_140587197.1 | plasmid-related protein | - |
| PUN50_RS03545 (PUN50_03545) | - | 753185..753604 (+) | 420 | WP_000795986.1 | single-stranded DNA-binding protein | - |
| PUN50_RS03550 (PUN50_03550) | bet | 753684..754502 (+) | 819 | WP_000414662.1 | phage recombination protein Bet | - |
| PUN50_RS03555 (PUN50_03555) | - | 754585..754728 (+) | 144 | WP_181161418.1 | hypothetical protein | - |
| PUN50_RS03560 (PUN50_03560) | - | 754789..755805 (+) | 1017 | WP_140587196.1 | YqaJ viral recombinase family protein | - |
| PUN50_RS03565 (PUN50_03565) | - | 756015..756974 (+) | 960 | WP_007104990.1 | AAA family ATPase | - |
| PUN50_RS03570 (PUN50_03570) | - | 756974..757741 (+) | 768 | WP_274290876.1 | hypothetical protein | - |
| PUN50_RS03575 (PUN50_03575) | - | 757840..758793 (+) | 954 | WP_085627050.1 | DUF3150 domain-containing protein | - |
| PUN50_RS03580 (PUN50_03580) | - | 758855..759295 (+) | 441 | WP_274290877.1 | hypothetical protein | - |
| PUN50_RS03585 (PUN50_03585) | - | 759365..761020 (+) | 1656 | WP_274290878.1 | VWA domain-containing protein | - |
| PUN50_RS03590 (PUN50_03590) | radC | 761106..761603 (+) | 498 | WP_000791199.1 | RadC family protein | - |
| PUN50_RS03595 (PUN50_03595) | - | 761603..761944 (+) | 342 | WP_274290879.1 | plasmid-related protein | - |
| PUN50_RS03600 (PUN50_03600) | - | 762036..762143 (+) | 108 | Protein_632 | DNA primase | - |
| PUN50_RS03605 (PUN50_03605) | - | 762241..763479 (+) | 1239 | WP_240307111.1 | IS256-like element ISVa19 family transposase | - |
| PUN50_RS03610 (PUN50_03610) | - | 763528..764484 (+) | 957 | WP_274290880.1 | DUF7146 domain-containing protein | - |
| PUN50_RS03615 (PUN50_03615) | - | 764574..765281 (+) | 708 | WP_274290881.1 | hypothetical protein | - |
| PUN50_RS03620 (PUN50_03620) | - | 765433..766515 (-) | 1083 | WP_274290882.1 | flavin monoamine oxidase family protein | - |
| PUN50_RS03625 (PUN50_03625) | - | 766515..767192 (-) | 678 | WP_274290883.1 | SDR family NAD(P)-dependent oxidoreductase | - |
| PUN50_RS03630 (PUN50_03630) | - | 767182..767871 (-) | 690 | WP_274290884.1 | cupin domain-containing protein | - |
| PUN50_RS03635 (PUN50_03635) | - | 768079..768891 (-) | 813 | WP_274290885.1 | type 1 glutamine amidotransferase domain-containing protein | - |
| PUN50_RS03640 (PUN50_03640) | - | 768909..769259 (-) | 351 | WP_274290886.1 | carboxymuconolactone decarboxylase family protein | - |
| PUN50_RS03645 (PUN50_03645) | - | 769316..770089 (-) | 774 | WP_274290887.1 | SDR family NAD(P)-dependent oxidoreductase | - |
| PUN50_RS03650 (PUN50_03650) | - | 770252..771490 (-) | 1239 | WP_240307111.1 | IS256-like element ISVa19 family transposase | - |
| PUN50_RS03655 (PUN50_03655) | gcvA | 771724..772638 (+) | 915 | WP_274290888.1 | transcriptional regulator GcvA | - |
| PUN50_RS03660 (PUN50_03660) | - | 772774..773541 (+) | 768 | WP_274290889.1 | GAF domain-containing protein | - |
| PUN50_RS03665 (PUN50_03665) | - | 773590..774713 (+) | 1124 | WP_420794655.1 | IS3 family transposase | - |
Sequence
Protein
Download Length: 225 a.a. Molecular weight: 26416.59 Da Isoelectric Point: 8.2322
>NTDB_id=788962 PUN50_RS03530 WP_140587199.1 751088..751765(-) (ideA) [Vibrio campbellii strain 20220413_1]
MNRTNFLITFLIALFTIPAFAEHPTSFSQAKRFAREIYQDNQSTFYCGCSYNNDGAIDAASCGYEPRKQPKRGERLEWEH
VVSAWEIGHQRQCWQNGGRRNCEKNDPEFSKMVSDLHNLVPSVGELNGDRSNFRFGMIPNEPRAYGLCDFEVVFKDRRAE
PPANRQGDIARIYFYMRDQYGLRLSRQQTQLFEAWSRMDPVDEWEIKRNNRINALQGNKNYHIQK
MNRTNFLITFLIALFTIPAFAEHPTSFSQAKRFAREIYQDNQSTFYCGCSYNNDGAIDAASCGYEPRKQPKRGERLEWEH
VVSAWEIGHQRQCWQNGGRRNCEKNDPEFSKMVSDLHNLVPSVGELNGDRSNFRFGMIPNEPRAYGLCDFEVVFKDRRAE
PPANRQGDIARIYFYMRDQYGLRLSRQQTQLFEAWSRMDPVDEWEIKRNNRINALQGNKNYHIQK
Nucleotide
Download Length: 678 bp
>NTDB_id=788962 PUN50_RS03530 WP_140587199.1 751088..751765(-) (ideA) [Vibrio campbellii strain 20220413_1]
ATGAATAGAACTAATTTTCTCATTACCTTCTTAATAGCGTTGTTCACTATCCCTGCATTTGCAGAACACCCAACATCGTT
CAGCCAGGCAAAACGATTTGCCCGAGAAATTTACCAAGACAACCAGAGTACGTTTTACTGTGGATGTAGCTATAACAATG
ATGGTGCGATTGATGCTGCATCTTGCGGATATGAACCAAGGAAGCAACCGAAACGAGGAGAACGCTTAGAGTGGGAGCAC
GTTGTCTCAGCTTGGGAAATTGGCCATCAACGCCAATGCTGGCAAAATGGTGGTCGTCGGAACTGTGAAAAGAATGATCC
TGAGTTTTCTAAAATGGTGTCGGATCTCCATAACCTTGTACCATCTGTAGGAGAACTCAATGGGGATAGATCAAATTTTC
GATTTGGCATGATTCCGAATGAACCAAGAGCCTATGGTCTATGTGATTTCGAAGTTGTTTTCAAAGACCGTCGAGCAGAA
CCACCAGCTAACCGTCAGGGTGATATTGCTAGAATTTATTTCTACATGCGAGATCAATATGGCCTAAGACTAAGCAGGCA
ACAAACTCAGCTATTTGAAGCTTGGTCAAGAATGGACCCTGTTGACGAATGGGAGATTAAGCGAAACAACCGAATTAATG
CCTTACAAGGCAATAAAAACTATCATATACAAAAATAA
ATGAATAGAACTAATTTTCTCATTACCTTCTTAATAGCGTTGTTCACTATCCCTGCATTTGCAGAACACCCAACATCGTT
CAGCCAGGCAAAACGATTTGCCCGAGAAATTTACCAAGACAACCAGAGTACGTTTTACTGTGGATGTAGCTATAACAATG
ATGGTGCGATTGATGCTGCATCTTGCGGATATGAACCAAGGAAGCAACCGAAACGAGGAGAACGCTTAGAGTGGGAGCAC
GTTGTCTCAGCTTGGGAAATTGGCCATCAACGCCAATGCTGGCAAAATGGTGGTCGTCGGAACTGTGAAAAGAATGATCC
TGAGTTTTCTAAAATGGTGTCGGATCTCCATAACCTTGTACCATCTGTAGGAGAACTCAATGGGGATAGATCAAATTTTC
GATTTGGCATGATTCCGAATGAACCAAGAGCCTATGGTCTATGTGATTTCGAAGTTGTTTTCAAAGACCGTCGAGCAGAA
CCACCAGCTAACCGTCAGGGTGATATTGCTAGAATTTATTTCTACATGCGAGATCAATATGGCCTAAGACTAAGCAGGCA
ACAAACTCAGCTATTTGAAGCTTGGTCAAGAATGGACCCTGTTGACGAATGGGAGATTAAGCGAAACAACCGAATTAATG
CCTTACAAGGCAATAAAAACTATCATATACAAAAATAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ideA | Vibrio cholerae O1 str. 2010EL-1786 |
92.377 |
99.111 |
0.916 |
| dns | Vibrio parahaemolyticus RIMD 2210633 |
52.423 |
100 |
0.529 |
| dns | Aliivibrio fischeri ES114 |
51.316 |
100 |
0.52 |
| dns | Vibrio cholerae strain A1552 |
49.776 |
99.111 |
0.493 |
| dns | Campylobacter jejuni RM1221 |
37.5 |
99.556 |
0.373 |