Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   PUO95_RS07955 Genome accession   NZ_CP117823
Coordinates   1804519..1805013 (-) Length   164 a.a.
NCBI ID   WP_004089231.1    Uniprot ID   Q87DQ5
Organism   Xylella fastidiosa subsp. fastidiosa strain ICMP 8742     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1804079..1853460 1804519..1805013 within 0


Gene organization within MGE regions


Location: 1804079..1853460
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PUO95_RS07950 (PUO95_07950) - 1804079..1804243 (-) 165 WP_014607674.1 hypothetical protein -
  PUO95_RS07955 (PUO95_07955) ssb 1804519..1805013 (-) 495 WP_004089231.1 single-stranded DNA-binding protein Machinery gene
  PUO95_RS07960 (PUO95_07960) - 1805264..1806265 (+) 1002 WP_004083792.1 polyprenyl synthetase family protein -
  PUO95_RS07965 (PUO95_07965) cyoA 1806734..1807693 (+) 960 WP_011097726.1 ubiquinol oxidase subunit II -
  PUO95_RS07970 (PUO95_07970) cyoB 1807687..1809684 (+) 1998 WP_004083794.1 cytochrome o ubiquinol oxidase subunit I -
  PUO95_RS07975 (PUO95_07975) cyoC 1809690..1810298 (+) 609 WP_004089235.1 cytochrome o ubiquinol oxidase subunit III -
  PUO95_RS07980 (PUO95_07980) cyoD 1810298..1810639 (+) 342 WP_004089237.1 cytochrome o ubiquinol oxidase subunit IV -
  PUO95_RS07985 (PUO95_07985) - 1810935..1812017 (-) 1083 WP_038233030.1 phage late control D family protein -
  PUO95_RS07990 (PUO95_07990) - 1812008..1812226 (-) 219 WP_004088371.1 tail protein X -
  PUO95_RS07995 (PUO95_07995) - 1812223..1812705 (-) 483 WP_011097928.1 phage tail protein -
  PUO95_RS08000 (PUO95_08000) - 1812702..1814921 (-) 2220 WP_038233032.1 phage tail tape measure protein -
  PUO95_RS08005 (PUO95_08005) - 1815048..1815335 (-) 288 WP_011097930.1 phage tail assembly protein -
  PUO95_RS08010 (PUO95_08010) - 1815338..1815847 (-) 510 WP_004086986.1 phage major tail tube protein -
  PUO95_RS08015 (PUO95_08015) - 1815847..1817025 (-) 1179 WP_011097931.1 phage tail sheath family protein -
  PUO95_RS08020 (PUO95_08020) - 1817090..1818682 (-) 1593 WP_012382617.1 tail fiber domain-containing protein -
  PUO95_RS08025 (PUO95_08025) - 1818690..1819247 (-) 558 WP_011097610.1 phage tail protein I -
  PUO95_RS08030 (PUO95_08030) - 1819240..1820133 (-) 894 WP_274265311.1 baseplate J/gp47 family protein -
  PUO95_RS08035 (PUO95_08035) - 1820133..1820471 (-) 339 WP_004088650.1 GPW/gp25 family protein -
  PUO95_RS08040 (PUO95_08040) - 1820605..1820919 (+) 315 WP_004087029.1 type II toxin-antitoxin system RelE/ParE family toxin -
  PUO95_RS08045 (PUO95_08045) - 1820921..1821202 (+) 282 WP_004087027.1 XRE family transcriptional regulator -
  PUO95_RS08050 (PUO95_08050) - 1821214..1821513 (+) 300 WP_004087025.1 HigA family addiction module antitoxin -
  PUO95_RS08055 (PUO95_08055) - 1821518..1822105 (-) 588 WP_167405114.1 phage baseplate assembly protein V -
  PUO95_RS08060 (PUO95_08060) - 1822102..1822644 (-) 543 WP_011097613.1 hypothetical protein -
  PUO95_RS08065 (PUO95_08065) - 1822620..1823141 (-) 522 WP_011097614.1 hypothetical protein -
  PUO95_RS08070 (PUO95_08070) - 1823138..1823461 (-) 324 WP_011097935.1 hypothetical protein -
  PUO95_RS08075 (PUO95_08075) - 1823461..1823721 (-) 261 WP_038232801.1 hypothetical protein -
  PUO95_RS08080 (PUO95_08080) - 1823739..1825613 (-) 1875 WP_038232803.1 phage major capsid protein -
  PUO95_RS08085 (PUO95_08085) - 1825597..1827195 (-) 1599 WP_274265312.1 phage portal protein -
  PUO95_RS08090 (PUO95_08090) - 1827192..1827743 (-) 552 WP_038233040.1 hypothetical protein -
  PUO95_RS08095 (PUO95_08095) - 1827747..1829699 (-) 1953 WP_128712497.1 phage terminase large subunit family protein -
  PUO95_RS08100 (PUO95_08100) - 1829692..1830267 (-) 576 WP_004085150.1 terminase small subunit -
  PUO95_RS08105 (PUO95_08105) - 1830398..1830622 (-) 225 WP_167405113.1 hypothetical protein -
  PUO95_RS08110 (PUO95_08110) - 1830624..1831085 (-) 462 WP_038233047.1 hypothetical protein -
  PUO95_RS08115 (PUO95_08115) - 1831075..1831404 (-) 330 WP_004086884.1 phage holin family protein -
  PUO95_RS08120 (PUO95_08120) - 1831397..1831891 (-) 495 WP_072866401.1 lysozyme -
  PUO95_RS08125 (PUO95_08125) - 1831858..1832475 (-) 618 WP_038233051.1 hypothetical protein -
  PUO95_RS08130 (PUO95_08130) - 1832760..1832963 (-) 204 WP_128712495.1 hypothetical protein -
  PUO95_RS08135 (PUO95_08135) - 1833262..1835808 (-) 2547 WP_072866400.1 phage/plasmid primase, P4 family -
  PUO95_RS08140 (PUO95_08140) - 1835944..1836552 (-) 609 WP_128712493.1 BRO family protein -
  PUO95_RS08145 (PUO95_08145) - 1836549..1836935 (-) 387 WP_128712481.1 phage antirepressor protein -
  PUO95_RS08150 (PUO95_08150) - 1836932..1837318 (-) 387 WP_128712481.1 phage antirepressor protein -
  PUO95_RS08155 (PUO95_08155) - 1837315..1837959 (-) 645 WP_167405112.1 BRO family protein -
  PUO95_RS08160 (PUO95_08160) - 1837956..1838219 (-) 264 WP_243857815.1 hypothetical protein -
  PUO95_RS08165 (PUO95_08165) - 1838237..1838485 (-) 249 WP_128712489.1 hypothetical protein -
  PUO95_RS08170 (PUO95_08170) - 1838482..1838670 (-) 189 WP_004085135.1 hypothetical protein -
  PUO95_RS08175 (PUO95_08175) - 1838723..1839028 (+) 306 WP_004091234.1 hypothetical protein -
  PUO95_RS08180 (PUO95_08180) - 1839025..1839225 (-) 201 WP_057683780.1 Rha family transcriptional regulator -
  PUO95_RS08185 (PUO95_08185) - 1839299..1840069 (+) 771 WP_004085133.1 helix-turn-helix transcriptional regulator -
  PUO95_RS08190 (PUO95_08190) - 1840103..1840699 (+) 597 WP_072866408.1 hypothetical protein -
  PUO95_RS08195 (PUO95_08195) - 1840830..1841069 (-) 240 WP_128712491.1 hypothetical protein -
  PUO95_RS08200 (PUO95_08200) - 1841104..1841397 (-) 294 WP_038231792.1 hypothetical protein -
  PUO95_RS11825 - 1841851..1842198 (+) 348 WP_050812593.1 hypothetical protein -
  PUO95_RS08210 (PUO95_08210) - 1842195..1842656 (+) 462 WP_072866409.1 DUF1566 domain-containing protein -
  PUO95_RS08215 (PUO95_08215) - 1842656..1843057 (+) 402 WP_128712492.1 hypothetical protein -
  PUO95_RS08220 (PUO95_08220) - 1843054..1843245 (+) 192 WP_004086365.1 hypothetical protein -
  PUO95_RS08225 (PUO95_08225) - 1843269..1843460 (+) 192 WP_012382635.1 hypothetical protein -
  PUO95_RS08230 (PUO95_08230) - 1843492..1843689 (+) 198 WP_004090711.1 hypothetical protein -
  PUO95_RS08235 (PUO95_08235) - 1843676..1844194 (+) 519 WP_038232209.1 hypothetical protein -
  PUO95_RS08240 (PUO95_08240) - 1844191..1845468 (+) 1278 WP_012382637.1 DUF2800 domain-containing protein -
  PUO95_RS08245 (PUO95_08245) - 1845468..1846034 (+) 567 WP_004090881.1 DUF2815 family protein -
  PUO95_RS08250 (PUO95_08250) - 1846121..1847632 (+) 1512 WP_011097960.1 BRO family protein -
  PUO95_RS08255 (PUO95_08255) - 1847634..1849814 (+) 2181 WP_011097961.1 DNA polymerase -
  PUO95_RS08260 (PUO95_08260) - 1849811..1850089 (+) 279 WP_011097962.1 VRR-NUC domain-containing protein -
  PUO95_RS08265 (PUO95_08265) - 1850091..1850537 (-) 447 WP_012382639.1 DUF1640 domain-containing protein -
  PUO95_RS08270 (PUO95_08270) - 1850622..1852040 (+) 1419 WP_038233072.1 DEAD/DEAH box helicase -
  PUO95_RS08275 (PUO95_08275) - 1852037..1852201 (+) 165 WP_012382640.1 hypothetical protein -
  PUO95_RS08280 (PUO95_08280) - 1852194..1852451 (+) 258 WP_011097965.1 DUF4224 domain-containing protein -
  PUO95_RS08285 (PUO95_08285) - 1852441..1853460 (+) 1020 WP_011097966.1 tyrosine-type recombinase/integrase -

Sequence

Protein


Download         Length: 164 a.a.        Molecular weight: 18227.20 Da        Isoelectric Point: 5.9527

>NTDB_id=787786 PUO95_RS07955 WP_004089231.1 1804519..1805013(-) (ssb) [Xylella fastidiosa subsp. fastidiosa strain ICMP 8742]
MARGINKVILVGNLGNDPDIKYTQGGMTITTISLATTSVRKDKDGNTQERTEWHRVKFFGKLGEIAGEYLRKGSQCYIEG
SIRYDKFTGQDGQERYVTEIVADEMQMLGGRSDGGGMGGGGERPQRQTSQRQDYAPRRQTRQPSQSPQSSPPPMDDFADD
DIPF

Nucleotide


Download         Length: 495 bp        

>NTDB_id=787786 PUO95_RS07955 WP_004089231.1 1804519..1805013(-) (ssb) [Xylella fastidiosa subsp. fastidiosa strain ICMP 8742]
ATGGCCCGTGGTATCAATAAAGTCATCCTCGTCGGTAATCTCGGTAACGATCCGGATATCAAATACACCCAAGGTGGTAT
GACGATCACTACCATCAGCTTGGCGACAACCAGTGTTCGTAAGGACAAGGATGGCAATACCCAGGAGCGGACCGAATGGC
ACAGGGTCAAGTTTTTCGGAAAACTCGGTGAGATTGCCGGGGAATATCTACGTAAGGGATCACAGTGCTATATCGAAGGG
AGCATTCGCTATGACAAGTTCACTGGCCAGGATGGCCAAGAGCGCTATGTTACAGAGATTGTTGCTGATGAGATGCAAAT
GTTGGGTGGCCGTAGTGATGGTGGCGGTATGGGCGGGGGCGGTGAGCGCCCACAGCGTCAAACATCGCAGCGTCAGGATT
ACGCCCCACGTCGCCAGACCCGTCAGCCGTCACAGTCGCCGCAATCTTCACCGCCGCCGATGGACGATTTCGCTGATGAC
GATATTCCTTTCTAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(5-108)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB Q87DQ5

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Vibrio cholerae strain A1552

49.153

100

0.53
  ssb Glaesserella parasuis strain SC1401

46.927

100

0.512
  ssb Neisseria meningitidis MC58

41.618

100

0.439
  ssb Neisseria gonorrhoeae MS11

41.04

100

0.433