Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   PQQ27_RS05280 Genome accession   NZ_CP117238
Coordinates   1057283..1057753 (+) Length   156 a.a.
NCBI ID   WP_000934770.1    Uniprot ID   -
Organism   Staphylococcus aureus strain ATCC 23235     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1047709..1091621 1057283..1057753 within 0


Gene organization within MGE regions


Location: 1047709..1091621
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PQQ27_RS05205 (PQQ27_05205) - 1047709..1049094 (-) 1386 WP_000861313.1 recombinase family protein -
  PQQ27_RS05210 (PQQ27_05210) - 1049152..1050081 (-) 930 WP_001253415.1 DUF5067 domain-containing protein -
  PQQ27_RS05215 (PQQ27_05215) - 1050099..1050557 (-) 459 WP_000521395.1 ImmA/IrrE family metallo-endopeptidase -
  PQQ27_RS05220 (PQQ27_05220) - 1050579..1050893 (-) 315 WP_001118607.1 helix-turn-helix transcriptional regulator -
  PQQ27_RS05225 (PQQ27_05225) - 1051046..1051258 (+) 213 WP_000132644.1 helix-turn-helix transcriptional regulator -
  PQQ27_RS05230 (PQQ27_05230) - 1051335..1052099 (+) 765 WP_001148560.1 phage antirepressor -
  PQQ27_RS05235 (PQQ27_05235) - 1052116..1052310 (+) 195 WP_000390105.1 hypothetical protein -
  PQQ27_RS05240 (PQQ27_05240) - 1052514..1052744 (-) 231 WP_000395457.1 hypothetical protein -
  PQQ27_RS05245 (PQQ27_05245) - 1052794..1052940 (+) 147 WP_000230553.1 hypothetical protein -
  PQQ27_RS05250 (PQQ27_05250) - 1052924..1053085 (+) 162 WP_000066020.1 DUF1270 domain-containing protein -
  PQQ27_RS05255 (PQQ27_05255) - 1053178..1053438 (+) 261 WP_000291487.1 DUF1108 family protein -
  PQQ27_RS05260 (PQQ27_05260) - 1053447..1053710 (+) 264 WP_001205732.1 hypothetical protein -
  PQQ27_RS05265 (PQQ27_05265) - 1053719..1055662 (+) 1944 WP_000700567.1 AAA family ATPase -
  PQQ27_RS05270 (PQQ27_05270) - 1055664..1056584 (+) 921 WP_000138475.1 recombinase RecT -
  PQQ27_RS05275 (PQQ27_05275) - 1056665..1057282 (+) 618 WP_072460574.1 MBL fold metallo-hydrolase -
  PQQ27_RS05280 (PQQ27_05280) ssbA 1057283..1057753 (+) 471 WP_000934770.1 single-stranded DNA-binding protein Machinery gene
  PQQ27_RS05285 (PQQ27_05285) - 1057783..1058667 (+) 885 WP_000148301.1 DnaD domain protein -
  PQQ27_RS05290 (PQQ27_05290) - 1058674..1058892 (+) 219 WP_000338528.1 hypothetical protein -
  PQQ27_RS05295 (PQQ27_05295) - 1058901..1059305 (+) 405 WP_000401978.1 RusA family crossover junction endodeoxyribonuclease -
  PQQ27_RS05300 (PQQ27_05300) - 1059318..1059686 (+) 369 WP_000101275.1 SA1788 family PVL leukocidin-associated protein -
  PQQ27_RS05305 (PQQ27_05305) - 1059690..1059932 (+) 243 WP_000132292.1 SAV1978 family virulence-associated passenger protein -
  PQQ27_RS05310 (PQQ27_05310) - 1059946..1060152 (+) 207 WP_000693989.1 hypothetical protein -
  PQQ27_RS05315 (PQQ27_05315) - 1060155..1060559 (+) 405 WP_000695756.1 hypothetical protein -
  PQQ27_RS05320 (PQQ27_05320) - 1060556..1060903 (+) 348 WP_000979209.1 YopX family protein -
  PQQ27_RS05325 (PQQ27_05325) - 1060900..1061433 (+) 534 WP_000144697.1 hypothetical protein -
  PQQ27_RS05330 (PQQ27_05330) - 1061529..1061834 (+) 306 Protein_1009 acetyltransferase -
  PQQ27_RS05335 (PQQ27_05335) - 1061827..1061952 (+) 126 Protein_1010 DUF1024 family protein -
  PQQ27_RS05340 (PQQ27_05340) - 1062308..1062844 (+) 537 WP_001066444.1 dUTPase -
  PQQ27_RS05345 (PQQ27_05345) - 1062881..1063069 (+) 189 WP_115172208.1 DUF1381 domain-containing protein -
  PQQ27_RS05350 (PQQ27_05350) - 1063044..1063244 (+) 201 WP_001125015.1 hypothetical protein -
  PQQ27_RS05355 (PQQ27_05355) - 1063247..1063420 (+) 174 WP_001806316.1 transcriptional activator RinB -
  PQQ27_RS05360 (PQQ27_05360) - 1063421..1063567 (+) 147 WP_000989997.1 hypothetical protein -
  PQQ27_RS05365 (PQQ27_05365) - 1063582..1064001 (+) 420 WP_000058633.1 transcriptional regulator -
  PQQ27_RS05370 (PQQ27_05370) - 1064188..1064682 (+) 495 WP_001004406.1 terminase small subunit -
  PQQ27_RS05375 (PQQ27_05375) - 1064685..1065980 (+) 1296 WP_031869843.1 PBSX family phage terminase large subunit -
  PQQ27_RS05380 (PQQ27_05380) - 1065991..1067526 (+) 1536 WP_000921884.1 phage portal protein -
  PQQ27_RS05385 (PQQ27_05385) - 1067533..1068528 (+) 996 WP_001806313.1 minor capsid protein -
  PQQ27_RS05390 (PQQ27_05390) - 1068601..1068771 (+) 171 WP_000072207.1 hypothetical protein -
  PQQ27_RS05395 (PQQ27_05395) - 1068906..1069520 (+) 615 WP_000354309.1 DUF4355 domain-containing protein -
  PQQ27_RS05400 (PQQ27_05400) - 1069534..1070508 (+) 975 WP_000438508.1 phage major capsid protein -
  PQQ27_RS05405 (PQQ27_05405) - 1070530..1070817 (+) 288 WP_001114090.1 hypothetical protein -
  PQQ27_RS05410 (PQQ27_05410) - 1070826..1071158 (+) 333 WP_000208957.1 phage head-tail connector protein -
  PQQ27_RS05415 (PQQ27_05415) - 1071155..1071457 (+) 303 WP_001270300.1 hypothetical protein -
  PQQ27_RS05420 (PQQ27_05420) - 1071457..1071804 (+) 348 WP_001017810.1 HK97-gp10 family putative phage morphogenesis protein -
  PQQ27_RS05425 (PQQ27_05425) - 1071816..1072199 (+) 384 WP_000188655.1 hypothetical protein -
  PQQ27_RS05430 (PQQ27_05430) - 1072219..1072800 (+) 582 WP_000002581.1 phage major tail protein, TP901-1 family -
  PQQ27_RS05435 (PQQ27_05435) - 1072863..1073228 (+) 366 WP_001100161.1 tail assembly chaperone -
  PQQ27_RS05440 (PQQ27_05440) - 1073258..1073602 (+) 345 WP_000105584.1 hypothetical protein -
  PQQ27_RS05445 (PQQ27_05445) - 1073619..1077083 (+) 3465 WP_000141467.1 hypothetical protein -
  PQQ27_RS05450 (PQQ27_05450) - 1077096..1078043 (+) 948 WP_000350684.1 phage tail family protein -
  PQQ27_RS05455 (PQQ27_05455) - 1078052..1079953 (+) 1902 WP_000156405.1 SGNH/GDSL hydrolase family protein -
  PQQ27_RS05460 (PQQ27_05460) - 1079968..1081878 (+) 1911 WP_000369026.1 hypothetical protein -
  PQQ27_RS05465 (PQQ27_05465) - 1081878..1083701 (+) 1824 WP_000259602.1 phage baseplate upper protein -
  PQQ27_RS05470 (PQQ27_05470) - 1083701..1084078 (+) 378 WP_000705896.1 DUF2977 domain-containing protein -
  PQQ27_RS05475 (PQQ27_05475) - 1084082..1084255 (+) 174 WP_000782200.1 XkdX family protein -
  PQQ27_RS05480 (PQQ27_05480) - 1084295..1084594 (+) 300 WP_000466778.1 DUF2951 domain-containing protein -
  PQQ27_RS05485 (PQQ27_05485) - 1084731..1086629 (+) 1899 WP_000524015.1 glucosaminidase domain-containing protein -
  PQQ27_RS05490 (PQQ27_05490) - 1086642..1087880 (+) 1239 WP_000276641.1 BppU family phage baseplate upper protein -
  PQQ27_RS05495 (PQQ27_05495) - 1087886..1088281 (+) 396 WP_000398891.1 hypothetical protein -
  PQQ27_RS05500 (PQQ27_05500) - 1088339..1088593 (+) 255 WP_000611512.1 phage holin -
  PQQ27_RS05505 (PQQ27_05505) - 1088605..1089360 (+) 756 WP_000861038.1 CHAP domain-containing protein -
  PQQ27_RS05510 (PQQ27_05510) sak 1089551..1090042 (+) 492 WP_000920038.1 staphylokinase -
  PQQ27_RS05515 (PQQ27_05515) - 1090582..1091169 (+) 588 WP_000448197.1 hypothetical protein -
  PQQ27_RS05520 (PQQ27_05520) - 1091166..1091621 (+) 456 WP_000971220.1 hypothetical protein -

Sequence


Protein


Download         Length: 156 a.a.        Molecular weight: 17713.63 Da        Isoelectric Point: 5.2672

>NTDB_id=783007 PQQ27_RS05280 WP_000934770.1 1057283..1057753(+) (ssbA) [Staphylococcus aureus strain ATCC 23235]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLTGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANVPIEIDDNDLPF

Nucleotide


Download         Length: 471 bp        

>NTDB_id=783007 PQQ27_RS05280 WP_000934770.1 1057283..1057753(+) (ssbA) [Staphylococcus aureus strain ATCC 23235]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGACGGGCGTAGATGGTAGGTTACAAACGCGG
AATTATGAAAATAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGTTCCGATTGAAATAGATGACAATGATTTACCATTCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

55.367

100

0.628

  ssb Latilactobacillus sakei subsp. sakei 23K

50.588

100

0.551

  ssbB Bacillus subtilis subsp. subtilis str. 168

59.434

67.949

0.404

  ssb Glaesserella parasuis strain SC1401

32.203

100

0.365