Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   M9D40_RS07135 Genome accession   NZ_CP117196
Coordinates   1514509..1514961 (-) Length   150 a.a.
NCBI ID   WP_252759420.1    Uniprot ID   -
Organism   Pasteurella multocida strain P2237     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1499632..1557088 1514509..1514961 within 0


Gene organization within MGE regions


Location: 1499632..1557088
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  M9D40_RS07055 (M9D40_007055) ssb 1499632..1500132 (+) 501 WP_005725039.1 single-stranded DNA-binding protein Machinery gene
  M9D40_RS07060 (M9D40_007060) - 1501482..1505651 (+) 4170 WP_252759558.1 hypothetical protein -
  M9D40_RS07065 (M9D40_007065) - 1506433..1506759 (-) 327 WP_014668306.1 hypothetical protein -
  M9D40_RS07070 (M9D40_007070) folD 1506829..1507683 (-) 855 WP_014391440.1 bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD -
  M9D40_RS07085 (M9D40_007085) - 1508058..1509113 (-) 1056 WP_014391441.1 site-specific integrase -
  M9D40_RS07090 (M9D40_007090) - 1509017..1509319 (-) 303 WP_075271365.1 helix-turn-helix domain-containing protein -
  M9D40_RS07095 (M9D40_007095) - 1509450..1509746 (-) 297 WP_015691047.1 hypothetical protein -
  M9D40_RS07100 (M9D40_007100) - 1509810..1510466 (-) 657 WP_252759559.1 Bro-N domain-containing protein -
  M9D40_RS07105 (M9D40_007105) - 1510751..1511584 (-) 834 WP_170349484.1 KilA-N domain-containing protein -
  M9D40_RS07110 (M9D40_007110) - 1511677..1512474 (-) 798 WP_064964923.1 hypothetical protein -
  M9D40_RS07115 (M9D40_007115) - 1512693..1513073 (-) 381 WP_075271374.1 type II toxin-antitoxin system PemK/MazF family toxin -
  M9D40_RS07120 (M9D40_007120) - 1513241..1513456 (-) 216 WP_275875447.1 hypothetical protein -
  M9D40_RS07125 (M9D40_007125) - 1513465..1513962 (-) 498 WP_252759419.1 DUF551 domain-containing protein -
  M9D40_RS07130 (M9D40_007130) - 1514096..1514500 (-) 405 WP_078836126.1 hypothetical protein -
  M9D40_RS07135 (M9D40_007135) ssb 1514509..1514961 (-) 453 WP_252759420.1 single-stranded DNA-binding protein Machinery gene
  M9D40_RS07140 (M9D40_007140) - 1514961..1515620 (-) 660 WP_041423209.1 translocation protein TolB precursor -
  M9D40_RS07145 (M9D40_007145) - 1515607..1516560 (-) 954 WP_014391451.1 recombinase RecT -
  M9D40_RS07150 (M9D40_007150) - 1516562..1516849 (-) 288 WP_014391452.1 hypothetical protein -
  M9D40_RS07155 (M9D40_007155) - 1516862..1517098 (-) 237 WP_075271355.1 hypothetical protein -
  M9D40_RS07160 (M9D40_007160) - 1517070..1517369 (-) 300 WP_078802174.1 hypothetical protein -
  M9D40_RS07165 (M9D40_007165) - 1517517..1517747 (+) 231 WP_223251317.1 hypothetical protein -
  M9D40_RS07170 (M9D40_007170) - 1517809..1518420 (-) 612 WP_252759421.1 antA/AntB antirepressor family protein -
  M9D40_RS07175 (M9D40_007175) - 1518747..1519547 (-) 801 WP_275875448.1 hypothetical protein -
  M9D40_RS07180 (M9D40_007180) - 1519766..1520146 (-) 381 WP_075271374.1 type II toxin-antitoxin system PemK/MazF family toxin -
  M9D40_RS07185 (M9D40_007185) - 1520330..1520455 (+) 126 WP_014391103.1 hypothetical protein -
  M9D40_RS07190 (M9D40_007190) - 1520456..1520989 (-) 534 WP_014391102.1 hypothetical protein -
  M9D40_RS07195 (M9D40_007195) - 1521077..1521340 (-) 264 WP_252759424.1 hypothetical protein -
  M9D40_RS07200 (M9D40_007200) - 1521429..1521806 (-) 378 WP_014390713.1 hypothetical protein -
  M9D40_RS07205 (M9D40_007205) - 1521781..1521972 (-) 192 WP_014391100.1 hypothetical protein -
  M9D40_RS07210 (M9D40_007210) - 1522366..1522593 (-) 228 WP_014391099.1 hypothetical protein -
  M9D40_RS07215 (M9D40_007215) - 1523213..1523917 (+) 705 WP_275875449.1 hypothetical protein -
  M9D40_RS07220 (M9D40_007220) - 1523986..1524762 (-) 777 WP_170389685.1 XRE family transcriptional regulator -
  M9D40_RS07225 (M9D40_007225) - 1524890..1525075 (+) 186 WP_046339050.1 Cro/CI family transcriptional regulator -
  M9D40_RS07230 (M9D40_007230) - 1525124..1525573 (+) 450 WP_078819884.1 YmfL family putative regulatory protein -
  M9D40_RS07235 (M9D40_007235) - 1525631..1526314 (+) 684 WP_252759426.1 phage antirepressor KilAC domain-containing protein -
  M9D40_RS07240 (M9D40_007240) - 1526399..1527217 (+) 819 WP_015691057.1 hypothetical protein -
  M9D40_RS07245 (M9D40_007245) - 1527214..1528578 (+) 1365 WP_015691058.1 replicative DNA helicase -
  M9D40_RS07250 (M9D40_007250) - 1528575..1529114 (+) 540 WP_078802161.1 MT-A70 family methyltransferase -
  M9D40_RS07255 (M9D40_007255) - 1529124..1529474 (+) 351 WP_015691060.1 hypothetical protein -
  M9D40_RS07260 (M9D40_007260) - 1529496..1530002 (+) 507 WP_015691061.1 DUF1367 family protein -
  M9D40_RS07265 (M9D40_007265) - 1530087..1530737 (+) 651 WP_015691062.1 metallophosphoesterase -
  M9D40_RS07270 (M9D40_007270) - 1530811..1531026 (+) 216 WP_014667790.1 hypothetical protein -
  M9D40_RS07275 (M9D40_007275) - 1531019..1531621 (+) 603 WP_195187204.1 recombination protein NinG -
  M9D40_RS07280 (M9D40_007280) - 1531621..1531986 (+) 366 WP_014390729.1 antiterminator Q family protein -
  M9D40_RS07285 (M9D40_007285) - 1532062..1532637 (+) 576 WP_014390730.1 hypothetical protein -
  M9D40_RS07290 (M9D40_007290) - 1532925..1533542 (+) 618 WP_014390731.1 KilA-N domain-containing protein -
  M9D40_RS07295 (M9D40_007295) - 1533617..1533856 (+) 240 WP_078819661.1 hypothetical protein -
  M9D40_RS07300 (M9D40_007300) - 1533976..1534314 (+) 339 WP_252759427.1 phage holin, lambda family -
  M9D40_RS07305 (M9D40_007305) - 1534345..1534929 (+) 585 WP_252759428.1 glycoside hydrolase family 19 protein -
  M9D40_RS07310 (M9D40_007310) - 1534932..1535255 (+) 324 WP_016569983.1 DUF2570 family protein -
  M9D40_RS07315 (M9D40_007315) - 1535465..1535833 (-) 369 WP_014391478.1 helix-turn-helix transcriptional regulator -
  M9D40_RS07320 (M9D40_007320) - 1535869..1536129 (-) 261 WP_005720780.1 type II toxin-antitoxin system RelE/ParE family toxin -
  M9D40_RS07325 (M9D40_007325) - 1536419..1536892 (+) 474 WP_014391479.1 DUF1441 family protein -
  M9D40_RS07330 (M9D40_007330) - 1536896..1539004 (+) 2109 WP_014391480.1 phage terminase large subunit family protein -
  M9D40_RS07335 (M9D40_007335) - 1539001..1539222 (+) 222 WP_014391481.1 hypothetical protein -
  M9D40_RS07340 (M9D40_007340) - 1539219..1540757 (+) 1539 WP_099803045.1 phage portal protein -
  M9D40_RS07345 (M9D40_007345) - 1540693..1542699 (+) 2007 WP_014391483.1 ClpP-like prohead protease/major capsid protein fusion protein -
  M9D40_RS07350 (M9D40_007350) - 1542771..1543097 (+) 327 WP_005719720.1 capsid cement protein -
  M9D40_RS07355 (M9D40_007355) - 1543090..1543383 (+) 294 WP_014391484.1 hypothetical protein -
  M9D40_RS07360 (M9D40_007360) - 1543383..1543934 (+) 552 WP_014391485.1 phage tail protein -
  M9D40_RS07365 (M9D40_007365) gpU 1543931..1544338 (+) 408 WP_014391486.1 phage tail terminator protein -
  M9D40_RS07370 (M9D40_007370) - 1544335..1544844 (+) 510 WP_014391487.1 phage tail tube protein -
  M9D40_RS07375 (M9D40_007375) - 1544847..1545236 (+) 390 WP_014391488.1 phage minor tail protein G -
  M9D40_RS07380 (M9D40_007380) - 1545257..1545559 (+) 303 WP_228376255.1 phage tail assembly protein T -
  M9D40_RS07385 (M9D40_007385) - 1545576..1547939 (+) 2364 WP_252759560.1 phage tail length tape measure family protein -
  M9D40_RS07390 (M9D40_007390) - 1547936..1548286 (+) 351 WP_005719622.1 phage tail protein -
  M9D40_RS07395 (M9D40_007395) - 1548575..1549288 (+) 714 WP_252759429.1 phage minor tail protein L -
  M9D40_RS07400 (M9D40_007400) - 1549292..1550035 (+) 744 WP_252759430.1 C40 family peptidase -
  M9D40_RS07405 (M9D40_007405) - 1549978..1550568 (+) 591 WP_042743292.1 tail assembly protein -
  M9D40_RS07410 (M9D40_007410) - 1550572..1555578 (+) 5007 WP_252759431.1 phage tail protein -
  M9D40_RS07415 (M9D40_007415) - 1555626..1555949 (+) 324 WP_014390761.1 hypothetical protein -
  M9D40_RS07420 (M9D40_007420) - 1556669..1557088 (+) 420 WP_005719426.1 DUF417 family protein -

Sequence

Protein


Download         Length: 150 a.a.        Molecular weight: 17029.92 Da        Isoelectric Point: 7.9779

>NTDB_id=782721 M9D40_RS07135 WP_252759420.1 1514509..1514961(-) (ssb) [Pasteurella multocida strain P2237]
MAGVNRVIILGNLGSDPEIRTMPNGDPVAKISVATSESWIDKNTNERKTQTEWHSIVFYRRQAEICGQYLKKGSKVYVEG
KLRTRKWQDQNGQDRYTTEIQGDVLQMLDSRQDSQQQQAQAPQNNAYANAKAGKPVQQQVGNFEEDNIPF

Nucleotide


Download         Length: 453 bp        

>NTDB_id=782721 M9D40_RS07135 WP_252759420.1 1514509..1514961(-) (ssb) [Pasteurella multocida strain P2237]
ATGGCTGGGGTTAATCGTGTAATTATTTTAGGAAATTTAGGAAGCGATCCTGAAATCCGCACAATGCCAAATGGCGACCC
TGTGGCAAAAATCAGTGTGGCCACAAGTGAAAGCTGGATTGATAAAAACACAAACGAACGAAAAACACAAACTGAATGGC
ATTCTATCGTGTTCTATCGTCGCCAAGCAGAAATTTGCGGGCAGTATTTGAAGAAAGGCTCGAAAGTTTATGTGGAAGGT
AAGCTCAGAACACGCAAATGGCAAGATCAAAATGGTCAAGACCGCTACACCACAGAGATTCAAGGCGACGTATTACAAAT
GCTAGACAGTCGCCAAGATTCACAGCAACAGCAAGCACAGGCACCACAAAATAATGCTTATGCGAATGCGAAAGCTGGAA
AGCCTGTACAACAACAGGTAGGTAACTTTGAAGAGGATAATATCCCGTTTTGA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(4-108)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Glaesserella parasuis strain SC1401

59.669

100

0.72
  ssb Vibrio cholerae strain A1552

52.518

92.667

0.487
  ssb Neisseria gonorrhoeae MS11

44.526

91.333

0.407
  ssb Neisseria meningitidis MC58

44.526

91.333

0.407