Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   PRR80_RS12415 Genome accession   NZ_CP117166
Coordinates   2653763..2654260 (+) Length   165 a.a.
NCBI ID   WP_017827302.1    Uniprot ID   -
Organism   Proteus mirabilis strain 181-3b     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2611503..2658528 2653763..2654260 within 0


Gene organization within MGE regions


Location: 2611503..2658528
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PRR80_RS12135 (PRR80_12135) - 2611503..2611928 (+) 426 WP_099659355.1 antirestriction protein -
  PRR80_RS12140 (PRR80_12140) - 2612169..2612603 (+) 435 WP_006814844.1 antirestriction protein -
  PRR80_RS12145 (PRR80_12145) - 2612705..2613541 (+) 837 WP_250250211.1 DUF932 domain-containing protein -
  PRR80_RS12150 (PRR80_12150) - 2614169..2614903 (+) 735 WP_219108978.1 outer membrane protein -
  PRR80_RS12155 (PRR80_12155) - 2615045..2615908 (+) 864 WP_219108981.1 hypothetical protein -
  PRR80_RS12160 (PRR80_12160) - 2615925..2616293 (+) 369 WP_240102567.1 hypothetical protein -
  PRR80_RS12165 (PRR80_12165) - 2616290..2616652 (+) 363 WP_214208557.1 hypothetical protein -
  PRR80_RS12170 (PRR80_12170) - 2617701..2618075 (+) 375 WP_273630045.1 hypothetical protein -
  PRR80_RS12175 (PRR80_12175) - 2618541..2618771 (+) 231 WP_233902349.1 helix-turn-helix domain-containing protein -
  PRR80_RS12180 (PRR80_12180) - 2618949..2620361 (-) 1413 WP_273630046.1 hypothetical protein -
  PRR80_RS12185 (PRR80_12185) - 2620436..2621449 (-) 1014 WP_152964252.1 DUF6453 family protein -
  PRR80_RS12190 (PRR80_12190) - 2621439..2625176 (-) 3738 WP_273630050.1 phage tail tip fiber protein -
  PRR80_RS12195 (PRR80_12195) - 2625177..2625575 (-) 399 WP_049210594.1 DUF6950 family protein -
  PRR80_RS12200 (PRR80_12200) - 2625629..2625904 (-) 276 WP_250316864.1 hypothetical protein -
  PRR80_RS12205 (PRR80_12205) - 2625918..2626499 (-) 582 WP_104836564.1 hypothetical protein -
  PRR80_RS12210 (PRR80_12210) - 2626496..2627095 (-) 600 WP_273630062.1 hypothetical protein -
  PRR80_RS12215 (PRR80_12215) - 2627096..2630401 (-) 3306 WP_273630064.1 phage tail tape measure protein -
  PRR80_RS12220 (PRR80_12220) - 2630658..2631008 (-) 351 WP_017827267.1 phage tail protein -
  PRR80_RS12225 (PRR80_12225) - 2631008..2631484 (-) 477 WP_017827268.1 major tail shaft subunit -
  PRR80_RS12230 (PRR80_12230) - 2631507..2631911 (-) 405 WP_017827269.1 HK97-gp10 family putative phage morphogenesis protein -
  PRR80_RS12235 (PRR80_12235) - 2631908..2632297 (-) 390 WP_017827270.1 hypothetical protein -
  PRR80_RS12240 (PRR80_12240) - 2632284..2632610 (-) 327 WP_112843676.1 phage head closure protein -
  PRR80_RS12245 (PRR80_12245) - 2632617..2632958 (-) 342 WP_371014621.1 head-tail connector protein -
  PRR80_RS12250 (PRR80_12250) - 2633005..2634234 (-) 1230 WP_196557400.1 phage major capsid protein -
  PRR80_RS12255 (PRR80_12255) - 2634250..2634855 (-) 606 WP_036905264.1 HK97 family phage prohead protease -
  PRR80_RS12260 (PRR80_12260) - 2634845..2636074 (-) 1230 WP_036905261.1 phage portal protein -
  PRR80_RS12265 (PRR80_12265) - 2636064..2636225 (-) 162 WP_167759273.1 hypothetical protein -
  PRR80_RS12270 (PRR80_12270) - 2636222..2637955 (-) 1734 WP_273630075.1 terminase large subunit -
  PRR80_RS12275 (PRR80_12275) - 2637959..2638429 (-) 471 WP_196535178.1 phage terminase small subunit P27 family -
  PRR80_RS12280 (PRR80_12280) - 2638576..2638773 (-) 198 WP_049218006.1 hypothetical protein -
  PRR80_RS12285 (PRR80_12285) - 2638770..2639120 (-) 351 WP_273630082.1 HNH endonuclease -
  PRR80_RS12290 (PRR80_12290) - 2639181..2639531 (-) 351 WP_273630084.1 hypothetical protein -
  PRR80_RS12295 (PRR80_12295) - 2640080..2640541 (-) 462 WP_004250565.1 lysis protein -
  PRR80_RS12300 (PRR80_12300) - 2640544..2640702 (-) 159 WP_004250562.1 hypothetical protein -
  PRR80_RS12305 (PRR80_12305) - 2640684..2641154 (-) 471 WP_004250560.1 lysozyme -
  PRR80_RS12310 (PRR80_12310) - 2641154..2641423 (-) 270 WP_049211167.1 bacteriophage protein -
  PRR80_RS12315 (PRR80_12315) - 2641787..2641981 (+) 195 WP_273630097.1 DUF1883 domain-containing protein -
  PRR80_RS12320 (PRR80_12320) - 2642030..2642209 (-) 180 WP_049219097.1 hypothetical protein -
  PRR80_RS12325 (PRR80_12325) - 2642323..2643345 (-) 1023 WP_273630100.1 DNA-methyltransferase -
  PRR80_RS12330 (PRR80_12330) - 2643413..2643592 (-) 180 WP_126656782.1 hypothetical protein -
  PRR80_RS12335 (PRR80_12335) - 2643769..2644449 (-) 681 WP_036901017.1 bacteriophage antitermination protein Q -
  PRR80_RS12340 (PRR80_12340) - 2644477..2645502 (-) 1026 WP_259695805.1 DUF968 domain-containing protein -
  PRR80_RS12345 (PRR80_12345) - 2645499..2646302 (-) 804 WP_273630111.1 KilA-N domain-containing protein -
  PRR80_RS12350 (PRR80_12350) - 2646321..2646704 (-) 384 WP_036904907.1 RusA family crossover junction endodeoxyribonuclease -
  PRR80_RS12355 (PRR80_12355) - 2646777..2647172 (-) 396 WP_049210572.1 hypothetical protein -
  PRR80_RS12360 (PRR80_12360) - 2647169..2647807 (-) 639 WP_141192256.1 phage N-6-adenine-methyltransferase -
  PRR80_RS12365 (PRR80_12365) - 2647807..2648868 (-) 1062 WP_273630121.1 conserved phage C-terminal domain-containing protein -
  PRR80_RS12370 (PRR80_12370) - 2648865..2649059 (-) 195 WP_420492261.1 hypothetical protein -
  PRR80_RS12375 (PRR80_12375) - 2649056..2649229 (-) 174 WP_004251659.1 hypothetical protein -
  PRR80_RS12380 (PRR80_12380) - 2649317..2649775 (-) 459 WP_036900998.1 YmfL family putative regulatory protein -
  PRR80_RS12385 (PRR80_12385) - 2649791..2650300 (-) 510 WP_237612479.1 hypothetical protein -
  PRR80_RS12390 (PRR80_12390) - 2650510..2650725 (-) 216 WP_273630135.1 helix-turn-helix domain-containing protein -
  PRR80_RS12395 (PRR80_12395) - 2650823..2651512 (+) 690 WP_049211705.1 XRE family transcriptional regulator -
  PRR80_RS12400 (PRR80_12400) - 2651660..2651863 (+) 204 WP_273630136.1 hypothetical protein -
  PRR80_RS12405 (PRR80_12405) rdgC 2652259..2653155 (+) 897 WP_074924366.1 recombination-associated protein RdgC -
  PRR80_RS12410 (PRR80_12410) - 2653237..2653770 (+) 534 WP_196749318.1 HD family hydrolase -
  PRR80_RS12415 (PRR80_12415) ssb 2653763..2654260 (+) 498 WP_017827302.1 single-stranded DNA-binding protein Machinery gene
  PRR80_RS12420 (PRR80_12420) - 2654300..2654473 (+) 174 WP_174820767.1 DUF7167 family protein -
  PRR80_RS12425 (PRR80_12425) - 2654476..2655171 (+) 696 WP_064506364.1 hypothetical protein -
  PRR80_RS12430 (PRR80_12430) - 2655171..2655566 (+) 396 WP_064506363.1 hypothetical protein -
  PRR80_RS12440 (PRR80_12440) - 2655791..2656972 (+) 1182 WP_126656794.1 site-specific integrase -
  PRR80_RS12445 (PRR80_12445) - 2657288..2658528 (+) 1241 Protein_2408 integrase -

Sequence


Protein


Download         Length: 165 a.a.        Molecular weight: 18066.48 Da        Isoelectric Point: 7.1640

>NTDB_id=782491 PRR80_RS12415 WP_017827302.1 2653763..2654260(+) (ssb) [Proteus mirabilis strain 181-3b]
MANGSVNKVILIGNLGRDPEIRYLPSGGAIAYLAVATSEKWRDKQTGENREKTEWHRVVLFGKLADIASGYLCKGSQVYI
EGQLQTREWDDNGVKRYTTEVVVRIGGTLQMLGGASKSAGSQPAQQNPPPAQPQAQSSQPPMDFEDDIPFAPIGLMYPRH
LINVV

Nucleotide


Download         Length: 498 bp        

>NTDB_id=782491 PRR80_RS12415 WP_017827302.1 2653763..2654260(+) (ssb) [Proteus mirabilis strain 181-3b]
ATGGCTAACGGATCAGTAAACAAAGTAATTCTTATCGGCAATTTAGGGCGTGATCCTGAAATTCGTTATCTTCCTTCTGG
TGGTGCTATTGCTTATTTAGCTGTGGCCACATCAGAGAAATGGCGTGACAAACAAACGGGTGAAAATCGCGAAAAAACAG
AATGGCATCGTGTTGTTCTGTTTGGAAAACTCGCTGATATCGCCAGTGGCTATTTGTGTAAAGGCTCGCAAGTTTATATC
GAGGGCCAACTACAAACGCGCGAGTGGGATGATAACGGCGTTAAACGCTACACAACAGAAGTTGTTGTAAGGATTGGAGG
CACATTGCAGATGTTGGGCGGTGCTAGTAAATCAGCAGGATCACAACCAGCACAGCAAAACCCGCCACCTGCTCAACCTC
AAGCACAGAGTAGTCAGCCACCAATGGATTTTGAGGATGATATTCCCTTCGCACCTATTGGGCTTATGTATCCACGCCAT
TTAATTAATGTGGTTTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Vibrio cholerae strain A1552

55.932

100

0.6

  ssb Glaesserella parasuis strain SC1401

48.889

100

0.533

  ssb Neisseria meningitidis MC58

41.379

100

0.436

  ssb Neisseria gonorrhoeae MS11

41.379

100

0.436