Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   QYM42_RS11540 Genome accession   NZ_CP129526
Coordinates   2315643..2315927 (-) Length   94 a.a.
NCBI ID   WP_025017139.1    Uniprot ID   -
Organism   Lactococcus lactis strain ZZ-2     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2310643..2320927
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QYM42_RS11510 (QYM42_11510) - 2311083..2311460 (-) 378 WP_033900715.1 pyridoxamine 5'-phosphate oxidase family protein -
  QYM42_RS11515 (QYM42_11515) - 2311665..2312531 (+) 867 WP_251899925.1 RluA family pseudouridine synthase -
  QYM42_RS11520 (QYM42_11520) - 2312569..2313378 (-) 810 WP_014570791.1 metal ABC transporter permease -
  QYM42_RS11525 (QYM42_11525) - 2313371..2314108 (-) 738 WP_012898617.1 metal ABC transporter ATP-binding protein -
  QYM42_RS11530 (QYM42_11530) - 2314285..2315127 (-) 843 WP_015427160.1 metal ABC transporter substrate-binding protein -
  QYM42_RS11535 (QYM42_11535) - 2315124..2315561 (-) 438 WP_201248645.1 zinc-dependent MarR family transcriptional regulator -
  QYM42_RS11540 (QYM42_11540) comGG 2315643..2315927 (-) 285 WP_025017139.1 competence type IV pilus minor pilin ComGG Machinery gene
  QYM42_RS11545 (QYM42_11545) comGF 2315966..2316412 (-) 447 WP_029344525.1 competence type IV pilus minor pilin ComGF Machinery gene
  QYM42_RS11550 (QYM42_11550) comGE 2316375..2316671 (-) 297 WP_010906316.1 competence type IV pilus minor pilin ComGE Machinery gene
  QYM42_RS11555 (QYM42_11555) comGD 2316643..2317059 (-) 417 WP_032941843.1 competence type IV pilus minor pilin ComGD Machinery gene
  QYM42_RS11560 (QYM42_11560) comGC 2317034..2317303 (-) 270 WP_021721869.1 competence type IV pilus major pilin ComGC Machinery gene
  QYM42_RS11570 (QYM42_11570) - 2317797..2317997 (-) 201 WP_058203534.1 cold-shock protein -
  QYM42_RS11575 (QYM42_11575) - 2319243..2319686 (-) 444 WP_301675256.1 type II toxin-antitoxin system PemK/MazF family toxin -
  QYM42_RS11580 (QYM42_11580) - 2319713..2320525 (-) 813 WP_301675257.1 DUF3800 domain-containing protein -
  QYM42_RS11585 (QYM42_11585) - 2320638..2320814 (-) 177 WP_301675258.1 hypothetical protein -

Sequence

Protein


Download         Length: 94 a.a.        Molecular weight: 10813.05 Da        Isoelectric Point: 5.0604

>NTDB_id=779743 QYM42_RS11540 WP_025017139.1 2315643..2315927(-) (comGG) [Lactococcus lactis strain ZZ-2]
MFSMFLQFYLERQIDDARQLRSEKEQLTAELMVSVALKTDLKSQGQIHFDSGDLSYNLLTDSSASSKITDHSSDENTYQF
SIHLKDGTNFQIKK

Nucleotide


Download         Length: 285 bp        

>NTDB_id=779743 QYM42_RS11540 WP_025017139.1 2315643..2315927(-) (comGG) [Lactococcus lactis strain ZZ-2]
ATGTTTTCAATGTTTCTTCAGTTCTATTTGGAAAGGCAAATAGATGATGCTCGACAATTAAGAAGTGAAAAGGAGCAGTT
AACAGCTGAATTAATGGTGTCAGTAGCTTTAAAGACTGATTTAAAATCTCAAGGTCAAATTCATTTTGATTCAGGGGATT
TGTCCTACAATTTACTGACAGACTCGTCAGCTAGTTCAAAAATTACTGACCATTCAAGTGATGAAAATACCTATCAATTT
AGTATCCATCTAAAAGATGGCACAAACTTTCAAATAAAAAAATAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Lactococcus lactis subsp. cremoris KW2

58.511

100

0.585