Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   PIB33_RS13180 Genome accession   NZ_CP116391
Coordinates   2517409..2517792 (-) Length   127 a.a.
NCBI ID   WP_032722118.1    Uniprot ID   -
Organism   Bacillus subtilis strain GXD-20     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2512409..2522792
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PIB33_RS13140 (PIB33_13140) sinI 2513342..2513515 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  PIB33_RS13145 (PIB33_13145) sinR 2513549..2513884 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  PIB33_RS13150 (PIB33_13150) tasA 2513977..2514762 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  PIB33_RS13155 (PIB33_13155) sipW 2514826..2515398 (-) 573 WP_072692741.1 signal peptidase I SipW -
  PIB33_RS13160 (PIB33_13160) tapA 2515382..2516143 (-) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  PIB33_RS13165 (PIB33_13165) yqzG 2516415..2516741 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  PIB33_RS13170 (PIB33_13170) spoIITA 2516783..2516962 (-) 180 WP_029726723.1 YqzE family protein -
  PIB33_RS13175 (PIB33_13175) comGG 2517034..2517408 (-) 375 WP_029726722.1 ComG operon protein ComGG Machinery gene
  PIB33_RS13180 (PIB33_13180) comGF 2517409..2517792 (-) 384 WP_032722118.1 ComG operon protein ComGF Machinery gene
  PIB33_RS13185 (PIB33_13185) comGE 2517818..2518165 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  PIB33_RS13190 (PIB33_13190) comGD 2518149..2518580 (-) 432 WP_029726720.1 comG operon protein ComGD Machinery gene
  PIB33_RS13195 (PIB33_13195) comGC 2518570..2518866 (-) 297 WP_029726719.1 comG operon protein ComGC Machinery gene
  PIB33_RS13200 (PIB33_13200) comGB 2518880..2519917 (-) 1038 WP_029317912.1 comG operon protein ComGB Machinery gene
  PIB33_RS13205 (PIB33_13205) comGA 2519904..2520974 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  PIB33_RS13210 (PIB33_13210) - 2521187..2521384 (-) 198 WP_014480259.1 CBS domain-containing protein -
  PIB33_RS13215 (PIB33_13215) corA 2521386..2522339 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14375.50 Da        Isoelectric Point: 5.8940

>NTDB_id=777024 PIB33_RS13180 WP_032722118.1 2517409..2517792(-) (comGF) [Bacillus subtilis strain GXD-20]
MLISGSLAAIIHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFEIYHSMIRKRVDG
KGHVPILDHITAMKADFENCVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=777024 PIB33_RS13180 WP_032722118.1 2517409..2517792(-) (comGF) [Bacillus subtilis strain GXD-20]
TTGCTCATATCAGGATCGTTAGCTGCGATTATCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGGCAGGACATCCGTTTCGAAATTTATCATTCAATGATAAGAAAAAGAGTGGATGGT
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATTTTGAAAATTGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

97.638

100

0.976