Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   PIB33_RS13140 Genome accession   NZ_CP116391
Coordinates   2513342..2513515 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain GXD-20     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2508342..2518515
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PIB33_RS13125 (PIB33_13125) gcvT 2509141..2510229 (-) 1089 WP_004398598.1 glycine cleavage system aminomethyltransferase GcvT -
  PIB33_RS13130 (PIB33_13130) hepAA 2510671..2512344 (+) 1674 WP_029726726.1 DEAD/DEAH box helicase -
  PIB33_RS13135 (PIB33_13135) yqhG 2512365..2513159 (+) 795 WP_015714249.1 YqhG family protein -
  PIB33_RS13140 (PIB33_13140) sinI 2513342..2513515 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  PIB33_RS13145 (PIB33_13145) sinR 2513549..2513884 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  PIB33_RS13150 (PIB33_13150) tasA 2513977..2514762 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  PIB33_RS13155 (PIB33_13155) sipW 2514826..2515398 (-) 573 WP_072692741.1 signal peptidase I SipW -
  PIB33_RS13160 (PIB33_13160) tapA 2515382..2516143 (-) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  PIB33_RS13165 (PIB33_13165) yqzG 2516415..2516741 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  PIB33_RS13170 (PIB33_13170) spoIITA 2516783..2516962 (-) 180 WP_029726723.1 YqzE family protein -
  PIB33_RS13175 (PIB33_13175) comGG 2517034..2517408 (-) 375 WP_029726722.1 ComG operon protein ComGG Machinery gene
  PIB33_RS13180 (PIB33_13180) comGF 2517409..2517792 (-) 384 WP_032722118.1 ComG operon protein ComGF Machinery gene
  PIB33_RS13185 (PIB33_13185) comGE 2517818..2518165 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=777021 PIB33_RS13140 WP_003230187.1 2513342..2513515(+) (sinI) [Bacillus subtilis strain GXD-20]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=777021 PIB33_RS13140 WP_003230187.1 2513342..2513515(+) (sinI) [Bacillus subtilis strain GXD-20]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1