Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   QWI19_RS12210 Genome accession   NZ_CP129123
Coordinates   2379769..2379942 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0ABU0V3E4
Organism   Bacillus subtilis strain 6D1     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2374769..2384942
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QWI19_RS12195 gcvT 2375568..2376656 (-) 1089 WP_015251720.1 glycine cleavage system aminomethyltransferase GcvT -
  QWI19_RS12200 hepAA 2377098..2378771 (+) 1674 WP_004398544.1 DEAD/DEAH box helicase -
  QWI19_RS12205 yqhG 2378792..2379586 (+) 795 WP_003230200.1 YqhG family protein -
  QWI19_RS12210 sinI 2379769..2379942 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  QWI19_RS12215 sinR 2379976..2380311 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  QWI19_RS12220 tasA 2380404..2381189 (-) 786 WP_015251717.1 biofilm matrix protein TasA -
  QWI19_RS12225 sipW 2381253..2381825 (-) 573 WP_003246088.1 signal peptidase I SipW -
  QWI19_RS12230 tapA 2381809..2382570 (-) 762 WP_015251716.1 amyloid fiber anchoring/assembly protein TapA -
  QWI19_RS12235 yqzG 2382842..2383168 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  QWI19_RS12240 spoIITA 2383210..2383389 (-) 180 WP_029726723.1 YqzE family protein -
  QWI19_RS12245 comGG 2383460..2383834 (-) 375 WP_015251714.1 ComG operon protein ComGG Machinery gene
  QWI19_RS12250 comGF 2383835..2384218 (-) 384 WP_015251713.1 ComG operon protein ComGF Machinery gene
  QWI19_RS12255 comGE 2384244..2384591 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=777026 QWI19_RS12210 WP_003230187.1 2379769..2379942(+) (sinI) [Bacillus subtilis strain 6D1]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=777026 QWI19_RS12210 WP_003230187.1 2379769..2379942(+) (sinI) [Bacillus subtilis strain 6D1]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1