Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   QWI19_RS12250 Genome accession   NZ_CP129123
Coordinates   2383835..2384218 (-) Length   127 a.a.
NCBI ID   WP_015251713.1    Uniprot ID   -
Organism   Bacillus subtilis strain 6D1     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2378835..2389218
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QWI19_RS12210 sinI 2379769..2379942 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  QWI19_RS12215 sinR 2379976..2380311 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  QWI19_RS12220 tasA 2380404..2381189 (-) 786 WP_015251717.1 biofilm matrix protein TasA -
  QWI19_RS12225 sipW 2381253..2381825 (-) 573 WP_003246088.1 signal peptidase I SipW -
  QWI19_RS12230 tapA 2381809..2382570 (-) 762 WP_015251716.1 amyloid fiber anchoring/assembly protein TapA -
  QWI19_RS12235 yqzG 2382842..2383168 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  QWI19_RS12240 spoIITA 2383210..2383389 (-) 180 WP_029726723.1 YqzE family protein -
  QWI19_RS12245 comGG 2383460..2383834 (-) 375 WP_015251714.1 ComG operon protein ComGG Machinery gene
  QWI19_RS12250 comGF 2383835..2384218 (-) 384 WP_015251713.1 ComG operon protein ComGF Machinery gene
  QWI19_RS12255 comGE 2384244..2384591 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  QWI19_RS12260 comGD 2384575..2385006 (-) 432 WP_004398628.1 comG operon protein ComGD Machinery gene
  QWI19_RS12265 comGC 2384996..2385292 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  QWI19_RS12270 comGB 2385306..2386343 (-) 1038 WP_044052501.1 comG operon protein ComGB Machinery gene
  QWI19_RS12275 comGA 2386330..2387400 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  QWI19_RS12280 - 2387613..2387810 (-) 198 WP_014480259.1 CBS domain-containing protein -
  QWI19_RS12285 corA 2387812..2388765 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14280.43 Da        Isoelectric Point: 6.4838

>NTDB_id=777029 QWI19_RS12250 WP_015251713.1 2383835..2384218(-) (comGF) [Bacillus subtilis strain 6D1]
MLISGSLAAIIHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIKNGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=777029 QWI19_RS12250 WP_015251713.1 2383835..2384218(-) (comGF) [Bacillus subtilis strain 6D1]
TTGCTCATATCAGGATCGTTAGCTGCGATTATCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTAAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACAGCTTTTCCGGTCTATTCGTATTTAGGAGGAGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

99.213

100

0.992