Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | PIG43_RS02690 | Genome accession | NZ_CP116387 |
| Coordinates | 548357..548710 (-) | Length | 117 a.a. |
| NCBI ID | WP_002014678.1 | Uniprot ID | A0A0D5YEH0 |
| Organism | Acinetobacter baumannii strain WM98 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 545991..576133 | 548357..548710 | within | 0 |
Gene organization within MGE regions
Location: 545991..576133
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PIG43_RS02670 (PIG43_02670) | - | 545991..547058 (+) | 1068 | WP_000107854.1 | site-specific integrase | - |
| PIG43_RS02675 (PIG43_02675) | - | 547086..547382 (-) | 297 | WP_000218943.1 | hypothetical protein | - |
| PIG43_RS02680 (PIG43_02680) | - | 547379..547600 (-) | 222 | WP_000424605.1 | hypothetical protein | - |
| PIG43_RS02685 (PIG43_02685) | - | 547610..548347 (-) | 738 | WP_000125747.1 | 3'-5' exonuclease | - |
| PIG43_RS02690 (PIG43_02690) | ssb | 548357..548710 (-) | 354 | WP_002014678.1 | single-stranded DNA-binding protein | Machinery gene |
| PIG43_RS02695 (PIG43_02695) | - | 548698..549015 (-) | 318 | WP_000049658.1 | hypothetical protein | - |
| PIG43_RS02700 (PIG43_02700) | - | 549008..549178 (-) | 171 | WP_001015076.1 | hypothetical protein | - |
| PIG43_RS02705 (PIG43_02705) | - | 549168..549719 (-) | 552 | WP_001178668.1 | hypothetical protein | - |
| PIG43_RS02710 (PIG43_02710) | - | 549785..550117 (-) | 333 | WP_000632296.1 | hypothetical protein | - |
| PIG43_RS02715 (PIG43_02715) | - | 550114..552852 (-) | 2739 | WP_002014340.1 | toprim domain-containing protein | - |
| PIG43_RS02720 (PIG43_02720) | - | 552946..553137 (-) | 192 | WP_001043481.1 | hypothetical protein | - |
| PIG43_RS02725 (PIG43_02725) | - | 553230..553571 (+) | 342 | WP_000786719.1 | helix-turn-helix transcriptional regulator | - |
| PIG43_RS02730 (PIG43_02730) | - | 553616..553831 (-) | 216 | WP_000556351.1 | hypothetical protein | - |
| PIG43_RS02735 (PIG43_02735) | - | 553932..554177 (-) | 246 | WP_031977998.1 | hypothetical protein | - |
| PIG43_RS02740 (PIG43_02740) | - | 554180..554374 (-) | 195 | WP_031978001.1 | hypothetical protein | - |
| PIG43_RS02745 (PIG43_02745) | - | 554809..555264 (+) | 456 | WP_031978003.1 | hypothetical protein | - |
| PIG43_RS02750 (PIG43_02750) | - | 555573..555773 (-) | 201 | WP_000130087.1 | TraR/DksA C4-type zinc finger protein | - |
| PIG43_RS02755 (PIG43_02755) | - | 555770..556009 (-) | 240 | WP_000113725.1 | ogr/Delta-like zinc finger family protein | - |
| PIG43_RS02760 (PIG43_02760) | - | 556140..557453 (-) | 1314 | WP_031978010.1 | contractile injection system protein, VgrG/Pvc8 family | - |
| PIG43_RS02765 (PIG43_02765) | - | 557454..557894 (-) | 441 | WP_000979758.1 | phage tail protein | - |
| PIG43_RS02770 (PIG43_02770) | - | 557900..560440 (-) | 2541 | WP_000067299.1 | phage tail tape measure protein | - |
| PIG43_RS02780 (PIG43_02780) | - | 560593..560934 (-) | 342 | WP_001071613.1 | phage tail assembly protein | - |
| PIG43_RS02785 (PIG43_02785) | - | 561002..561520 (-) | 519 | WP_001207610.1 | phage major tail tube protein | - |
| PIG43_RS02790 (PIG43_02790) | - | 561533..562708 (-) | 1176 | WP_000963360.1 | phage tail sheath protein | - |
| PIG43_RS02795 (PIG43_02795) | - | 562858..564810 (-) | 1953 | WP_000729646.1 | phage tail protein | - |
| PIG43_RS02800 (PIG43_02800) | - | 564822..565427 (-) | 606 | WP_001050805.1 | phage tail protein I | - |
| PIG43_RS02805 (PIG43_02805) | - | 565427..566329 (-) | 903 | WP_000109738.1 | baseplate J/gp47 family protein | - |
| PIG43_RS02810 (PIG43_02810) | - | 566326..566673 (-) | 348 | WP_000987745.1 | GPW/gp25 family protein | - |
| PIG43_RS02815 (PIG43_02815) | - | 566670..567302 (-) | 633 | WP_000990625.1 | phage baseplate assembly protein V | - |
| PIG43_RS02820 (PIG43_02820) | - | 567375..567824 (-) | 450 | WP_001059843.1 | phage virion morphogenesis protein | - |
| PIG43_RS02825 (PIG43_02825) | - | 567821..568348 (-) | 528 | WP_000742888.1 | phage tail protein | - |
| PIG43_RS02830 (PIG43_02830) | - | 568345..569175 (-) | 831 | WP_000600982.1 | N-acetylmuramidase family protein | - |
| PIG43_RS02835 (PIG43_02835) | - | 569172..569441 (-) | 270 | WP_000571491.1 | phage holin family protein | - |
| PIG43_RS02840 (PIG43_02840) | - | 569438..569788 (-) | 351 | WP_001114936.1 | putative holin | - |
| PIG43_RS02845 (PIG43_02845) | - | 569797..570006 (-) | 210 | WP_000659474.1 | tail protein X | - |
| PIG43_RS02850 (PIG43_02850) | - | 570007..570459 (-) | 453 | WP_000015691.1 | head completion/stabilization protein | - |
| PIG43_RS02855 (PIG43_02855) | gpM | 570563..571309 (-) | 747 | WP_000950641.1 | phage terminase small subunit | - |
| PIG43_RS02860 (PIG43_02860) | - | 571320..572309 (-) | 990 | WP_001243259.1 | phage major capsid protein, P2 family | - |
| PIG43_RS02865 (PIG43_02865) | - | 572362..573189 (-) | 828 | WP_000748563.1 | GPO family capsid scaffolding protein | - |
| PIG43_RS02870 (PIG43_02870) | - | 573327..575135 (+) | 1809 | WP_000289875.1 | terminase family protein | - |
| PIG43_RS02875 (PIG43_02875) | - | 575135..576133 (+) | 999 | WP_001284079.1 | phage portal protein | - |
Sequence
Protein
Download Length: 117 a.a. Molecular weight: 13365.13 Da Isoelectric Point: 9.7939
>NTDB_id=776943 PIG43_RS02690 WP_002014678.1 548357..548710(-) (ssb) [Acinetobacter baumannii strain WM98]
MRGINKVILVGMLGANPIPKQFQNGGSYAQFSIATSEKYQDKRTGDWIENTEWHRIVAHNRLGEIACQFLKKGSKVYIEG
SLHTRKWTDQNNQERYVTEVRAITFQSLDSLPQANPV
MRGINKVILVGMLGANPIPKQFQNGGSYAQFSIATSEKYQDKRTGDWIENTEWHRIVAHNRLGEIACQFLKKGSKVYIEG
SLHTRKWTDQNNQERYVTEVRAITFQSLDSLPQANPV
Nucleotide
Download Length: 354 bp
>NTDB_id=776943 PIG43_RS02690 WP_002014678.1 548357..548710(-) (ssb) [Acinetobacter baumannii strain WM98]
ATGCGCGGAATAAATAAAGTGATCTTGGTTGGAATGCTTGGTGCTAACCCAATTCCTAAACAATTTCAAAACGGTGGCTC
CTATGCTCAGTTTTCAATTGCCACTTCAGAAAAATACCAGGACAAACGCACTGGAGATTGGATTGAAAATACTGAGTGGC
ATCGGATTGTGGCTCACAACCGCCTAGGTGAAATTGCCTGTCAATTTCTCAAAAAAGGTTCAAAAGTTTATATCGAAGGC
TCATTACATACCCGGAAATGGACTGACCAAAATAATCAAGAACGTTACGTAACTGAAGTTAGAGCCATTACATTTCAATC
GCTCGATAGCTTGCCACAAGCAAACCCGGTTTAA
ATGCGCGGAATAAATAAAGTGATCTTGGTTGGAATGCTTGGTGCTAACCCAATTCCTAAACAATTTCAAAACGGTGGCTC
CTATGCTCAGTTTTCAATTGCCACTTCAGAAAAATACCAGGACAAACGCACTGGAGATTGGATTGAAAATACTGAGTGGC
ATCGGATTGTGGCTCACAACCGCCTAGGTGAAATTGCCTGTCAATTTCTCAAAAAAGGTTCAAAAGTTTATATCGAAGGC
TCATTACATACCCGGAAATGGACTGACCAAAATAATCAAGAACGTTACGTAACTGAAGTTAGAGCCATTACATTTCAATC
GCTCGATAGCTTGCCACAAGCAAACCCGGTTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Glaesserella parasuis strain SC1401 |
55.455 |
94.017 |
0.521 |
| ssb | Vibrio cholerae strain A1552 |
54.545 |
84.615 |
0.462 |
| ssb | Neisseria gonorrhoeae MS11 |
42.857 |
89.744 |
0.385 |
| ssb | Neisseria meningitidis MC58 |
42.857 |
89.744 |
0.385 |