Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | PJW05_RS16850 | Genome accession | NZ_CP116304 |
| Coordinates | 3638210..3638662 (+) | Length | 150 a.a. |
| NCBI ID | WP_271408130.1 | Uniprot ID | - |
| Organism | Pseudomonas sp. Q1-7 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 3621947..3668783 | 3638210..3638662 | within | 0 |
Gene organization within MGE regions
Location: 3621947..3668783
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PJW05_RS16750 | - | 3621947..3622642 (+) | 696 | WP_271408110.1 | lytic transglycosylase domain-containing protein | - |
| PJW05_RS16755 | - | 3622611..3622973 (+) | 363 | WP_271408111.1 | hypothetical protein | - |
| PJW05_RS16760 | - | 3622986..3623384 (+) | 399 | WP_271408112.1 | conjugal transfer protein | - |
| PJW05_RS16765 | - | 3623362..3625800 (+) | 2439 | WP_271408113.1 | conjugal transfer protein | - |
| PJW05_RS16770 | - | 3625942..3626268 (+) | 327 | WP_271408114.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| PJW05_RS16775 | - | 3626265..3626552 (+) | 288 | WP_271408115.1 | XRE family transcriptional regulator | - |
| PJW05_RS16780 | - | 3626674..3627054 (-) | 381 | WP_271408116.1 | hypothetical protein | - |
| PJW05_RS16785 | virB5 | 3627294..3627947 (+) | 654 | WP_271408117.1 | P-type DNA transfer protein VirB5 | - |
| PJW05_RS16790 | - | 3627963..3628319 (+) | 357 | WP_271408118.1 | hypothetical protein | - |
| PJW05_RS16795 | - | 3628331..3629278 (+) | 948 | WP_271408119.1 | type IV secretion system protein | - |
| PJW05_RS16800 | - | 3629356..3629520 (+) | 165 | WP_271408120.1 | hypothetical protein | - |
| PJW05_RS16805 | - | 3629501..3630280 (+) | 780 | WP_271408121.1 | type IV secretion system protein | - |
| PJW05_RS16810 | - | 3630277..3631083 (+) | 807 | WP_271408122.1 | TrbG/VirB9 family P-type conjugative transfer protein | - |
| PJW05_RS16815 | - | 3631067..3632311 (+) | 1245 | WP_271408123.1 | TrbI/VirB10 family protein | - |
| PJW05_RS16820 | virB11 | 3632321..3633358 (+) | 1038 | WP_271408124.1 | P-type DNA transfer ATPase VirB11 | - |
| PJW05_RS16825 | - | 3633355..3633528 (+) | 174 | WP_271408125.1 | hypothetical protein | - |
| PJW05_RS16830 | - | 3633631..3633927 (+) | 297 | WP_271408126.1 | hypothetical protein | - |
| PJW05_RS16835 | - | 3633893..3635440 (+) | 1548 | WP_271408127.1 | type IV secretory system conjugative DNA transfer family protein | - |
| PJW05_RS16840 | - | 3635495..3635833 (+) | 339 | WP_271408128.1 | TrbM/KikA/MpfK family conjugal transfer protein | - |
| PJW05_RS16845 | - | 3635945..3638194 (+) | 2250 | WP_271408129.1 | type IA DNA topoisomerase | - |
| PJW05_RS16850 | ssb | 3638210..3638662 (+) | 453 | WP_271408130.1 | single-stranded DNA-binding protein | Machinery gene |
| PJW05_RS16855 | - | 3638899..3639636 (+) | 738 | WP_271408131.1 | conjugal transfer protein TraL | - |
| PJW05_RS16860 | - | 3639646..3640251 (+) | 606 | WP_271408132.1 | hypothetical protein | - |
| PJW05_RS16865 | - | 3640271..3640576 (-) | 306 | WP_271408133.1 | TraK family protein | - |
| PJW05_RS16870 | - | 3640919..3641260 (+) | 342 | WP_271408134.1 | molybdopterin-guanine dinucleotide biosynthesis protein MobC | - |
| PJW05_RS26635 | - | 3641250..3644303 (+) | 3054 | WP_333908709.1 | LPD7 domain-containing protein | - |
| PJW05_RS16890 | - | 3644334..3645317 (+) | 984 | WP_271408136.1 | hypothetical protein | - |
| PJW05_RS16895 | - | 3645898..3646893 (-) | 996 | Protein_3314 | IS3 family transposase | - |
| PJW05_RS16900 | - | 3646993..3648150 (-) | 1158 | Protein_3315 | IS110 family transposase | - |
| PJW05_RS16905 | - | 3648375..3648635 (-) | 261 | Protein_3316 | transposase | - |
| PJW05_RS16910 | - | 3648917..3649378 (-) | 462 | Protein_3317 | enoyl-CoA hydratase-related protein | - |
| PJW05_RS16915 | - | 3649441..3650421 (+) | 981 | WP_014820685.1 | IS5-like element ISPst5 family transposase | - |
| PJW05_RS16920 | - | 3650556..3651002 (-) | 447 | WP_271408137.1 | enoyl-CoA hydratase-related protein | - |
| PJW05_RS16925 | - | 3651031..3652305 (-) | 1275 | WP_271408138.1 | CaiB/BaiF CoA-transferase family protein | - |
| PJW05_RS16930 | - | 3652330..3653997 (-) | 1668 | WP_271408139.1 | GMC family oxidoreductase N-terminal domain-containing protein | - |
| PJW05_RS16935 | - | 3654078..3654713 (-) | 636 | WP_271408140.1 | TetR/AcrR family transcriptional regulator | - |
| PJW05_RS16940 | - | 3654785..3656308 (-) | 1524 | WP_271408141.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
| PJW05_RS16945 | - | 3656425..3657366 (+) | 942 | WP_271408142.1 | LysR family transcriptional regulator | - |
| PJW05_RS16950 | - | 3657843..3658826 (-) | 984 | WP_271408143.1 | MDR family oxidoreductase | - |
| PJW05_RS16955 | - | 3659251..3660750 (+) | 1500 | WP_271408144.1 | aldehyde dehydrogenase family protein | - |
| PJW05_RS16960 | - | 3660814..3661938 (+) | 1125 | WP_271408145.1 | alkene reductase | - |
| PJW05_RS16965 | - | 3662004..3662969 (+) | 966 | WP_271408146.1 | LLM class oxidoreductase | - |
| PJW05_RS16970 | - | 3663118..3663423 (+) | 306 | WP_057384357.1 | helix-turn-helix transcriptional regulator | - |
| PJW05_RS16980 | - | 3664664..3665008 (-) | 345 | WP_271408148.1 | S24 family peptidase | - |
| PJW05_RS16985 | - | 3665098..3665826 (+) | 729 | WP_271408149.1 | SOS response-associated peptidase | - |
| PJW05_RS16990 | - | 3666047..3666754 (+) | 708 | WP_271408150.1 | helix-turn-helix transcriptional regulator | - |
| PJW05_RS16995 | - | 3667432..3667644 (+) | 213 | WP_271408151.1 | hypothetical protein | - |
| PJW05_RS17000 | - | 3667644..3668783 (+) | 1140 | WP_271408152.1 | tyrosine-type recombinase/integrase | - |
Sequence
Protein
Download Length: 150 a.a. Molecular weight: 16608.27 Da Isoelectric Point: 5.0351
>NTDB_id=776512 PJW05_RS16850 WP_271408130.1 3638210..3638662(+) (ssb) [Pseudomonas sp. Q1-7]
MARGINKVTLVGHLGGDPETRHSPNGNAVTTISLATSESWKDKQSGQQQERTEWHRVVFFGRLAEVAGEYLSKGSQVYIE
GSLRTRKWDKDGEDRYTTEVVVDMNGTLLLLGGRPEDGSAPRPAREARQPSQPAPQPERDDDGFDSDLPF
MARGINKVTLVGHLGGDPETRHSPNGNAVTTISLATSESWKDKQSGQQQERTEWHRVVFFGRLAEVAGEYLSKGSQVYIE
GSLRTRKWDKDGEDRYTTEVVVDMNGTLLLLGGRPEDGSAPRPAREARQPSQPAPQPERDDDGFDSDLPF
Nucleotide
Download Length: 453 bp
>NTDB_id=776512 PJW05_RS16850 WP_271408130.1 3638210..3638662(+) (ssb) [Pseudomonas sp. Q1-7]
ATGGCTCGCGGTATCAACAAAGTCACGCTGGTGGGTCACCTCGGTGGCGATCCGGAAACCCGCCACTCTCCCAACGGTAA
CGCCGTCACCACCATTTCCCTGGCCACCAGCGAGAGCTGGAAGGACAAGCAGAGCGGCCAGCAGCAGGAGCGCACCGAAT
GGCACCGCGTGGTGTTCTTCGGGCGCCTGGCTGAAGTCGCCGGGGAGTACCTGAGCAAGGGGAGTCAGGTCTACATCGAG
GGCAGTCTGCGCACCCGCAAATGGGACAAGGACGGCGAGGACCGCTACACCACCGAAGTGGTGGTCGACATGAACGGCAC
CCTGCTGCTGCTCGGCGGCCGTCCCGAGGATGGCAGCGCGCCACGCCCAGCGCGTGAAGCCCGGCAGCCCTCACAGCCCG
CTCCGCAGCCGGAGAGGGACGACGACGGCTTCGACTCCGATCTCCCCTTCTAA
ATGGCTCGCGGTATCAACAAAGTCACGCTGGTGGGTCACCTCGGTGGCGATCCGGAAACCCGCCACTCTCCCAACGGTAA
CGCCGTCACCACCATTTCCCTGGCCACCAGCGAGAGCTGGAAGGACAAGCAGAGCGGCCAGCAGCAGGAGCGCACCGAAT
GGCACCGCGTGGTGTTCTTCGGGCGCCTGGCTGAAGTCGCCGGGGAGTACCTGAGCAAGGGGAGTCAGGTCTACATCGAG
GGCAGTCTGCGCACCCGCAAATGGGACAAGGACGGCGAGGACCGCTACACCACCGAAGTGGTGGTCGACATGAACGGCAC
CCTGCTGCTGCTCGGCGGCCGTCCCGAGGATGGCAGCGCGCCACGCCCAGCGCGTGAAGCCCGGCAGCCCTCACAGCCCG
CTCCGCAGCCGGAGAGGGACGACGACGGCTTCGACTCCGATCTCCCCTTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Vibrio cholerae strain A1552 |
51.429 |
100 |
0.6 |
| ssb | Glaesserella parasuis strain SC1401 |
46.629 |
100 |
0.553 |
| ssb | Neisseria meningitidis MC58 |
45.89 |
97.333 |
0.447 |
| ssb | Neisseria gonorrhoeae MS11 |
45.89 |
97.333 |
0.447 |