Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   PF977_RS08785 Genome accession   NZ_CP116012
Coordinates   1682337..1682720 (+) Length   127 a.a.
NCBI ID   WP_038429292.1    Uniprot ID   -
Organism   Bacillus subtilis strain SRCM124333     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 1677337..1687720
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PF977_RS08750 (PF977_08750) corA 1677790..1678743 (+) 954 WP_004399136.1 magnesium transporter CorA -
  PF977_RS08755 (PF977_08755) - 1678745..1678942 (+) 198 WP_014480259.1 CBS domain-containing protein -
  PF977_RS08760 (PF977_08760) comGA 1679155..1680225 (+) 1071 WP_015714258.1 competence protein ComGA Machinery gene
  PF977_RS08765 (PF977_08765) comGB 1680212..1681249 (+) 1038 WP_015714257.1 comG operon protein ComGB Machinery gene
  PF977_RS08770 (PF977_08770) comGC 1681263..1681559 (+) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  PF977_RS08775 (PF977_08775) comGD 1681549..1681980 (+) 432 WP_015714255.1 comG operon protein ComGD Machinery gene
  PF977_RS08780 (PF977_08780) comGE 1681964..1682311 (+) 348 WP_015714254.1 ComG operon protein 5 Machinery gene
  PF977_RS08785 (PF977_08785) comGF 1682337..1682720 (+) 384 WP_038429292.1 ComG operon protein ComGF Machinery gene
  PF977_RS08790 (PF977_08790) comGG 1682721..1683095 (+) 375 WP_015714252.1 ComG operon protein ComGG Machinery gene
  PF977_RS08795 (PF977_08795) spoIITA 1683166..1683345 (+) 180 WP_014480252.1 YqzE family protein -
  PF977_RS08800 (PF977_08800) yqzG 1683387..1683713 (-) 327 WP_003246051.1 YqzG/YhdC family protein -
  PF977_RS08805 (PF977_08805) tapA 1683985..1684746 (+) 762 WP_015714251.1 amyloid fiber anchoring/assembly protein TapA -
  PF977_RS08810 (PF977_08810) sipW 1684730..1685302 (+) 573 WP_003230181.1 signal peptidase I SipW -
  PF977_RS08815 (PF977_08815) tasA 1685366..1686151 (+) 786 WP_015714250.1 biofilm matrix protein TasA -
  PF977_RS08820 (PF977_08820) sinR 1686244..1686579 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  PF977_RS08825 (PF977_08825) sinI 1686613..1686786 (-) 174 WP_003230187.1 anti-repressor SinI Regulator

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14547.68 Da        Isoelectric Point: 6.4849

>NTDB_id=775108 PF977_RS08785 WP_038429292.1 1682337..1682720(+) (comGF) [Bacillus subtilis strain SRCM124333]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSRQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADFENGVVLLKIESEDQKVYQTAFPVYSYLGGR

Nucleotide


Download         Length: 384 bp        

>NTDB_id=775108 PF977_RS08785 WP_038429292.1 1682337..1682720(+) (comGF) [Bacillus subtilis strain SRCM124333]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCAGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATTTTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGAGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

97.619

99.213

0.969