Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   PF977_RS08825 Genome accession   NZ_CP116012
Coordinates   1686613..1686786 (-) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain SRCM124333     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 1681613..1691786
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PF977_RS08780 (PF977_08780) comGE 1681964..1682311 (+) 348 WP_015714254.1 ComG operon protein 5 Machinery gene
  PF977_RS08785 (PF977_08785) comGF 1682337..1682720 (+) 384 WP_038429292.1 ComG operon protein ComGF Machinery gene
  PF977_RS08790 (PF977_08790) comGG 1682721..1683095 (+) 375 WP_015714252.1 ComG operon protein ComGG Machinery gene
  PF977_RS08795 (PF977_08795) spoIITA 1683166..1683345 (+) 180 WP_014480252.1 YqzE family protein -
  PF977_RS08800 (PF977_08800) yqzG 1683387..1683713 (-) 327 WP_003246051.1 YqzG/YhdC family protein -
  PF977_RS08805 (PF977_08805) tapA 1683985..1684746 (+) 762 WP_015714251.1 amyloid fiber anchoring/assembly protein TapA -
  PF977_RS08810 (PF977_08810) sipW 1684730..1685302 (+) 573 WP_003230181.1 signal peptidase I SipW -
  PF977_RS08815 (PF977_08815) tasA 1685366..1686151 (+) 786 WP_015714250.1 biofilm matrix protein TasA -
  PF977_RS08820 (PF977_08820) sinR 1686244..1686579 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  PF977_RS08825 (PF977_08825) sinI 1686613..1686786 (-) 174 WP_003230187.1 anti-repressor SinI Regulator
  PF977_RS08830 (PF977_08830) yqhG 1686969..1687763 (-) 795 WP_015714249.1 YqhG family protein -
  PF977_RS08835 (PF977_08835) hepAA 1687784..1689457 (-) 1674 WP_003230203.1 DEAD/DEAH box helicase -
  PF977_RS08840 (PF977_08840) gcvT 1689899..1690987 (+) 1089 WP_015714248.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=775111 PF977_RS08825 WP_003230187.1 1686613..1686786(-) (sinI) [Bacillus subtilis strain SRCM124333]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=775111 PF977_RS08825 WP_003230187.1 1686613..1686786(-) (sinI) [Bacillus subtilis strain SRCM124333]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1