Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   OSK17_RS22310 Genome accession   NZ_CP115738
Coordinates   4256750..4257268 (-) Length   172 a.a.
NCBI ID   WP_003219228.1    Uniprot ID   A0A063XE16
Organism   Bacillus subtilis strain W7     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 4216489..4256735 4256750..4257268 flank 15


Gene organization within MGE regions


Location: 4216489..4257268
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  OSK17_RS22055 (OSK17_22055) yybO 4216904..4218214 (+) 1311 WP_014478548.1 MFS transporter -
  OSK17_RS22060 (OSK17_22060) - 4218374..4219111 (+) 738 WP_043940254.1 MerR family transcriptional regulator -
  OSK17_RS22065 (OSK17_22065) - 4219149..4219937 (-) 789 WP_043940255.1 hypothetical protein -
  OSK17_RS22070 (OSK17_22070) yybH 4220005..4220392 (-) 388 Protein_4301 YybH family protein -
  OSK17_RS22075 (OSK17_22075) - 4220482..4220612 (-) 131 Protein_4302 LysR family transcriptional regulator -
  OSK17_RS22080 (OSK17_22080) yybB 4220620..4221282 (-) 663 WP_032724976.1 MBL fold metallo-hydrolase -
  OSK17_RS22085 (OSK17_22085) yybA 4221412..4221864 (-) 453 WP_003226875.1 MarR family transcriptional regulator -
  OSK17_RS22090 (OSK17_22090) yyaT 4221984..4222424 (+) 441 WP_041850273.1 GNAT family N-acetyltransferase -
  OSK17_RS22095 (OSK17_22095) yyaS 4222426..4223028 (+) 603 WP_043940256.1 YczE/YyaS/YitT family protein -
  OSK17_RS22100 (OSK17_22100) satA 4223095..4223616 (-) 522 WP_043940257.1 streptothricin N-acetyltransferase SatA -
  OSK17_RS22105 (OSK17_22105) yyaQ 4223996..4224352 (+) 357 WP_043940258.1 MmcQ/YjbR family DNA-binding protein -
  OSK17_RS22110 (OSK17_22110) yyaP 4224512..4225078 (+) 567 WP_021481097.1 dihydrofolate reductase family protein -
  OSK17_RS22115 (OSK17_22115) - 4225320..4225500 (+) 181 Protein_4310 DUF255 domain-containing protein -
  OSK17_RS22120 (OSK17_22120) - 4225568..4225987 (-) 420 WP_004398596.1 thioredoxin-dependent arsenate reductase -
  OSK17_RS22125 (OSK17_22125) acr3 4225999..4227039 (-) 1041 WP_119900017.1 arsenite efflux transporter Acr3 -
  OSK17_RS22130 (OSK17_22130) - 4227061..4227501 (-) 441 WP_119900019.1 ArsI/CadI family heavy metal resistance metalloenzyme -
  OSK17_RS22135 (OSK17_22135) arsR 4227561..4227878 (-) 318 WP_029318103.1 arsenical resistance operon transcriptional regulator ArsR -
  OSK17_RS22140 (OSK17_22140) - 4228153..4229661 (+) 1509 WP_119900021.1 recombinase family protein -
  OSK17_RS22145 (OSK17_22145) - 4229761..4230543 (-) 783 WP_119900023.1 hypothetical protein -
  OSK17_RS22150 (OSK17_22150) - 4230645..4231028 (-) 384 WP_119900025.1 cystatin-like fold lipoprotein -
  OSK17_RS22155 (OSK17_22155) - 4231091..4231597 (-) 507 WP_119900027.1 hypothetical protein -
  OSK17_RS22160 (OSK17_22160) cwlT 4231612..4232601 (-) 990 WP_119900029.1 bifunctional lytic transglycosylase/C40 family peptidase -
  OSK17_RS22165 (OSK17_22165) conG 4232598..4235045 (-) 2448 WP_119900031.1 CD3337/EF1877 family mobilome membrane protein -
  OSK17_RS22170 (OSK17_22170) yddF 4235049..4235375 (-) 327 WP_019716380.1 YddF family protein -
  OSK17_RS22175 (OSK17_22175) conE 4235393..4237888 (-) 2496 WP_119900033.1 VirB4-like ATPase ConE -
  OSK17_RS22180 (OSK17_22180) conD 4237776..4238300 (-) 525 WP_119900035.1 conjugal transfer protein -
  OSK17_RS22185 (OSK17_22185) - 4238313..4238561 (-) 249 WP_119900037.1 hypothetical protein -
  OSK17_RS22190 (OSK17_22190) conB 4238573..4239637 (-) 1065 WP_119900038.1 conjugal transfer protein -
  OSK17_RS22195 (OSK17_22195) - 4239655..4239813 (-) 159 WP_162920081.1 hypothetical protein -
  OSK17_RS22200 (OSK17_22200) - 4239831..4240109 (-) 279 WP_044430163.1 hypothetical protein -
  OSK17_RS22205 (OSK17_22205) - 4240126..4240392 (-) 267 WP_119900040.1 hypothetical protein -
  OSK17_RS22210 (OSK17_22210) nicK 4240659..4241717 (-) 1059 WP_119900042.1 DNA relaxase NicK -
  OSK17_RS22215 (OSK17_22215) - 4241710..4243161 (-) 1452 WP_119900044.1 DNA translocase FtsK -
  OSK17_RS22220 (OSK17_22220) helP 4243197..4243577 (-) 381 WP_119900046.1 helicase processivity factor HelP -
  OSK17_RS22225 (OSK17_22225) - 4243594..4243740 (-) 147 WP_119900048.1 hypothetical protein -
  OSK17_RS22230 (OSK17_22230) - 4243945..4244205 (-) 261 WP_119900050.1 hypothetical protein -
  OSK17_RS22235 (OSK17_22235) - 4244258..4244482 (-) 225 WP_206697900.1 hypothetical protein -
  OSK17_RS22240 (OSK17_22240) - 4244515..4244694 (-) 180 WP_119900054.1 ICEBs1 excisionase -
  OSK17_RS22245 (OSK17_22245) - 4244991..4245374 (+) 384 WP_019716391.1 helix-turn-helix domain-containing protein -
  OSK17_RS22250 (OSK17_22250) - 4245371..4245901 (+) 531 WP_019716392.1 ImmA/IrrE family metallo-endopeptidase -
  OSK17_RS22255 (OSK17_22255) - 4246014..4247210 (-) 1197 WP_271069397.1 Rap family tetratricopeptide repeat protein -
  OSK17_RS22260 (OSK17_22260) - 4247429..4248196 (+) 768 WP_119900058.1 hypothetical protein -
  OSK17_RS22265 (OSK17_22265) - 4248213..4249037 (+) 825 WP_119900060.1 hypothetical protein -
  OSK17_RS22270 (OSK17_22270) yyaL 4249042..4251131 (+) 2090 Protein_4341 thioredoxin domain-containing protein -
  OSK17_RS22275 (OSK17_22275) yyaK 4251128..4252027 (-) 900 WP_032724963.1 CPBP family intramembrane glutamic endopeptidase -
  OSK17_RS22280 (OSK17_22280) yyaJ 4252254..4253609 (+) 1356 WP_041850266.1 MFS transporter -
  OSK17_RS22285 (OSK17_22285) maa 4253643..4254197 (-) 555 WP_015250785.1 sugar O-acetyltransferase -
  OSK17_RS22290 (OSK17_22290) yyaH 4254213..4254593 (-) 381 WP_015715075.1 VOC family protein -
  OSK17_RS22295 (OSK17_22295) ccpB 4254649..4255584 (-) 936 WP_015715076.1 transcriptional regulator CcpB -
  OSK17_RS22300 (OSK17_22300) xth 4255644..4256402 (-) 759 WP_015250782.1 exodeoxyribonuclease III -
  OSK17_RS22305 (OSK17_22305) rpsR 4256467..4256706 (-) 240 WP_003219224.1 30S ribosomal protein S18 -
  OSK17_RS22310 (OSK17_22310) ssbA 4256750..4257268 (-) 519 WP_003219228.1 single-stranded DNA-binding protein SsbA Machinery gene

Sequence


Protein


Download         Length: 172 a.a.        Molecular weight: 18742.31 Da        Isoelectric Point: 4.7621

>NTDB_id=773695 OSK17_RS22310 WP_003219228.1 4256750..4257268(-) (ssbA) [Bacillus subtilis strain W7]
MLNRVVLVGRLTKDPELRYTPNGAAVATFTLAVNRTFTNQSGEREADFINCVTWRRQAENVANFLKKGSLAGVDGRLQTR
NYENQQGQRVFVTEVQAESVQFLEPKNGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQRRNQGNSFNDDPFANDG
KPIDISDDDLPF

Nucleotide


Download         Length: 519 bp        

>NTDB_id=773695 OSK17_RS22310 WP_003219228.1 4256750..4257268(-) (ssbA) [Bacillus subtilis strain W7]
ATGCTTAACCGAGTTGTATTAGTCGGAAGACTGACAAAAGACCCAGAGCTTCGTTATACGCCAAACGGTGCGGCTGTTGC
TACGTTTACTCTTGCTGTGAATCGTACATTTACGAACCAGTCCGGAGAACGTGAGGCCGATTTCATTAATTGTGTCACTT
GGAGAAGACAAGCCGAAAACGTTGCAAACTTCTTGAAAAAAGGAAGCCTTGCAGGCGTAGATGGCCGTTTACAAACAAGA
AACTATGAAAACCAGCAAGGACAGCGTGTCTTCGTGACAGAGGTCCAAGCTGAAAGTGTTCAATTTCTTGAGCCGAAAAA
CGGCGGCGGTTCTGGTTCAGGTGGATACAACGAAGGAAACAGCGGCGGAGGCCAGTACTTTGGCGGAGGCCAAAATGATA
ATCCATTTGGGGGAAATCAAAACAACCAGAGACGCAATCAGGGGAACAGCTTTAATGATGACCCATTTGCCAACGACGGC
AAACCGATTGACATCTCGGATGATGATCTTCCATTCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063XE16

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

100

100

1

  ssb Latilactobacillus sakei subsp. sakei 23K

58.192

100

0.599

  ssbB Bacillus subtilis subsp. subtilis str. 168

64.151

61.628

0.395

  ssb Glaesserella parasuis strain SC1401

35.519

100

0.378