Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   PAN99_RS11905 Genome accession   NZ_CP115604
Coordinates   2467124..2467501 (-) Length   125 a.a.
NCBI ID   WP_014305410.1    Uniprot ID   -
Organism   Bacillus velezensis strain FJAT-54560     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2462124..2472501
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PAN99_RS11865 (PAN99_11865) - 2462623..2463417 (+) 795 WP_014305407.1 YqhG family protein -
  PAN99_RS11870 (PAN99_11870) sinI 2463594..2463767 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  PAN99_RS11875 (PAN99_11875) sinR 2463801..2464136 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  PAN99_RS11880 (PAN99_11880) tasA 2464184..2464969 (-) 786 WP_015388008.1 biofilm matrix protein TasA -
  PAN99_RS11885 (PAN99_11885) sipW 2465033..2465617 (-) 585 WP_012117977.1 signal peptidase I SipW -
  PAN99_RS11890 (PAN99_11890) tapA 2465589..2466260 (-) 672 WP_003153099.1 amyloid fiber anchoring/assembly protein TapA -
  PAN99_RS11895 (PAN99_11895) - 2466519..2466848 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  PAN99_RS11900 (PAN99_11900) - 2466888..2467067 (-) 180 WP_003153093.1 YqzE family protein -
  PAN99_RS11905 (PAN99_11905) comGG 2467124..2467501 (-) 378 WP_014305410.1 competence type IV pilus minor pilin ComGG Machinery gene
  PAN99_RS11910 (PAN99_11910) comGF 2467502..2468002 (-) 501 WP_235570156.1 competence type IV pilus minor pilin ComGF -
  PAN99_RS11915 (PAN99_11915) comGE 2467911..2468225 (-) 315 WP_057080485.1 competence type IV pilus minor pilin ComGE Machinery gene
  PAN99_RS11920 (PAN99_11920) comGD 2468209..2468646 (-) 438 WP_015388002.1 competence type IV pilus minor pilin ComGD Machinery gene
  PAN99_RS11925 (PAN99_11925) comGC 2468636..2468944 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  PAN99_RS11930 (PAN99_11930) comGB 2468949..2469986 (-) 1038 WP_063174751.1 competence type IV pilus assembly protein ComGB Machinery gene
  PAN99_RS11935 (PAN99_11935) comGA 2469973..2471043 (-) 1071 WP_044053465.1 competence type IV pilus ATPase ComGA Machinery gene
  PAN99_RS11940 (PAN99_11940) - 2471235..2472185 (-) 951 WP_014305415.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 125 a.a.        Molecular weight: 14170.14 Da        Isoelectric Point: 9.9592

>NTDB_id=772728 PAN99_RS11905 WP_014305410.1 2467124..2467501(-) (comGG) [Bacillus velezensis strain FJAT-54560]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKVQTGTQRFPYGTVS
FRITGSDRRETVQVTIQAETVSGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=772728 PAN99_RS11905 WP_014305410.1 2467124..2467501(-) (comGG) [Bacillus velezensis strain FJAT-54560]
ATGTACAAATCTGACGGTTTTATCTATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCGAAAGAGGCCGGGGAGTACTGGATCGGAGAGAATCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTACGGAACTGTTTCC
TTCCGCATCACCGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCCGAAACAGTGTCAGGCACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains


Predicted by InterproScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

51.613

99.2

0.512