Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   PAN99_RS11870 Genome accession   NZ_CP115604
Coordinates   2463594..2463767 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain FJAT-54560     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2458594..2468767
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PAN99_RS11855 (PAN99_11855) gcvT 2459411..2460511 (-) 1101 WP_095315606.1 glycine cleavage system aminomethyltransferase GcvT -
  PAN99_RS11860 (PAN99_11860) - 2460935..2462605 (+) 1671 WP_003153107.1 DEAD/DEAH box helicase -
  PAN99_RS11865 (PAN99_11865) - 2462623..2463417 (+) 795 WP_014305407.1 YqhG family protein -
  PAN99_RS11870 (PAN99_11870) sinI 2463594..2463767 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  PAN99_RS11875 (PAN99_11875) sinR 2463801..2464136 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  PAN99_RS11880 (PAN99_11880) tasA 2464184..2464969 (-) 786 WP_015388008.1 biofilm matrix protein TasA -
  PAN99_RS11885 (PAN99_11885) sipW 2465033..2465617 (-) 585 WP_012117977.1 signal peptidase I SipW -
  PAN99_RS11890 (PAN99_11890) tapA 2465589..2466260 (-) 672 WP_003153099.1 amyloid fiber anchoring/assembly protein TapA -
  PAN99_RS11895 (PAN99_11895) - 2466519..2466848 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  PAN99_RS11900 (PAN99_11900) - 2466888..2467067 (-) 180 WP_003153093.1 YqzE family protein -
  PAN99_RS11905 (PAN99_11905) comGG 2467124..2467501 (-) 378 WP_014305410.1 competence type IV pilus minor pilin ComGG Machinery gene
  PAN99_RS11910 (PAN99_11910) comGF 2467502..2468002 (-) 501 WP_235570156.1 competence type IV pilus minor pilin ComGF -
  PAN99_RS11915 (PAN99_11915) comGE 2467911..2468225 (-) 315 WP_057080485.1 competence type IV pilus minor pilin ComGE Machinery gene
  PAN99_RS11920 (PAN99_11920) comGD 2468209..2468646 (-) 438 WP_015388002.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=772726 PAN99_RS11870 WP_003153105.1 2463594..2463767(+) (sinI) [Bacillus velezensis strain FJAT-54560]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=772726 PAN99_RS11870 WP_003153105.1 2463594..2463767(+) (sinI) [Bacillus velezensis strain FJAT-54560]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702