Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   O7R04_RS11355 Genome accession   NZ_CP115158
Coordinates   2372617..2372994 (-) Length   125 a.a.
NCBI ID   WP_015388005.1    Uniprot ID   -
Organism   Bacillus velezensis strain MBLB 0692     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2367617..2377994
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  O7R04_RS11315 (O7R04_11315) - 2368116..2368910 (+) 795 WP_014305407.1 YqhG family protein -
  O7R04_RS11320 (O7R04_11320) sinI 2369087..2369260 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  O7R04_RS11325 (O7R04_11325) sinR 2369294..2369629 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  O7R04_RS11330 (O7R04_11330) tasA 2369677..2370462 (-) 786 WP_003153102.1 biofilm matrix protein TasA -
  O7R04_RS11335 (O7R04_11335) sipW 2370526..2371110 (-) 585 WP_012117977.1 signal peptidase I SipW -
  O7R04_RS11340 (O7R04_11340) tapA 2371082..2371753 (-) 672 WP_003153099.1 amyloid fiber anchoring/assembly protein TapA -
  O7R04_RS11345 (O7R04_11345) - 2372012..2372341 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  O7R04_RS11350 (O7R04_11350) - 2372381..2372560 (-) 180 WP_003153093.1 YqzE family protein -
  O7R04_RS11355 (O7R04_11355) comGG 2372617..2372994 (-) 378 WP_015388005.1 competence type IV pilus minor pilin ComGG Machinery gene
  O7R04_RS11360 (O7R04_11360) comGF 2372995..2373390 (-) 396 WP_015388004.1 competence type IV pilus minor pilin ComGF -
  O7R04_RS11365 (O7R04_11365) comGE 2373404..2373718 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  O7R04_RS11370 (O7R04_11370) comGD 2373702..2374139 (-) 438 WP_043867285.1 competence type IV pilus minor pilin ComGD Machinery gene
  O7R04_RS11375 (O7R04_11375) comGC 2374129..2374437 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  O7R04_RS11380 (O7R04_11380) comGB 2374442..2375479 (-) 1038 WP_043867286.1 competence type IV pilus assembly protein ComGB Machinery gene
  O7R04_RS11385 (O7R04_11385) comGA 2375466..2376536 (-) 1071 WP_043867287.1 competence type IV pilus ATPase ComGA Machinery gene
  O7R04_RS11390 (O7R04_11390) - 2376734..2377684 (-) 951 WP_003153082.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 125 a.a.        Molecular weight: 14182.19 Da        Isoelectric Point: 9.9592

>NTDB_id=768425 O7R04_RS11355 WP_015388005.1 2372617..2372994(-) (comGG) [Bacillus velezensis strain MBLB 0692]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKVQTGIQRFPYGTVS
FRITGSDRRETVQVTIQAETVSGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=768425 O7R04_RS11355 WP_015388005.1 2372617..2372994(-) (comGG) [Bacillus velezensis strain MBLB 0692]
ATGTACAAATCTGACGGTTTTATCTATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCGAAAGAGGCCGGGGAGTACTGGATCGGAGAGAATCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTATACAGCGTTTTCCGTACGGAACTGTTTCC
TTCCGCATCACCGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCCGAAACAGTGTCAGGCACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains


Predicted by InterproScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

50.806

99.2

0.504