Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   O7R04_RS11320 Genome accession   NZ_CP115158
Coordinates   2369087..2369260 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain MBLB 0692     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2364087..2374260
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  O7R04_RS11305 (O7R04_11305) gcvT 2364905..2366005 (-) 1101 WP_014305405.1 glycine cleavage system aminomethyltransferase GcvT -
  O7R04_RS11310 (O7R04_11310) - 2366428..2368098 (+) 1671 WP_139885316.1 DEAD/DEAH box helicase -
  O7R04_RS11315 (O7R04_11315) - 2368116..2368910 (+) 795 WP_014305407.1 YqhG family protein -
  O7R04_RS11320 (O7R04_11320) sinI 2369087..2369260 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  O7R04_RS11325 (O7R04_11325) sinR 2369294..2369629 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  O7R04_RS11330 (O7R04_11330) tasA 2369677..2370462 (-) 786 WP_003153102.1 biofilm matrix protein TasA -
  O7R04_RS11335 (O7R04_11335) sipW 2370526..2371110 (-) 585 WP_012117977.1 signal peptidase I SipW -
  O7R04_RS11340 (O7R04_11340) tapA 2371082..2371753 (-) 672 WP_003153099.1 amyloid fiber anchoring/assembly protein TapA -
  O7R04_RS11345 (O7R04_11345) - 2372012..2372341 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  O7R04_RS11350 (O7R04_11350) - 2372381..2372560 (-) 180 WP_003153093.1 YqzE family protein -
  O7R04_RS11355 (O7R04_11355) comGG 2372617..2372994 (-) 378 WP_015388005.1 competence type IV pilus minor pilin ComGG Machinery gene
  O7R04_RS11360 (O7R04_11360) comGF 2372995..2373390 (-) 396 WP_015388004.1 competence type IV pilus minor pilin ComGF -
  O7R04_RS11365 (O7R04_11365) comGE 2373404..2373718 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  O7R04_RS11370 (O7R04_11370) comGD 2373702..2374139 (-) 438 WP_043867285.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=768423 O7R04_RS11320 WP_003153105.1 2369087..2369260(+) (sinI) [Bacillus velezensis strain MBLB 0692]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=768423 O7R04_RS11320 WP_003153105.1 2369087..2369260(+) (sinI) [Bacillus velezensis strain MBLB 0692]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGTCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702