Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   O9T43_RS03270 Genome accession   NZ_CP115041
Coordinates   670887..671366 (+) Length   159 a.a.
NCBI ID   WP_039194679.1    Uniprot ID   A0A467HC69
Organism   Listeria monocytogenes strain MKELm2_2022     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 662726..724267 670887..671366 within 0


Gene organization within MGE regions


Location: 662726..724267
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  O9T43_RS03190 (O9T43_03190) - 662726..663877 (-) 1152 WP_014930665.1 tyrosine-type recombinase/integrase -
  O9T43_RS03195 (O9T43_03195) - 663899..664612 (-) 714 WP_039187930.1 lipoprotein -
  O9T43_RS03200 (O9T43_03200) - 664667..665017 (-) 351 WP_223196558.1 ImmA/IrrE family metallo-endopeptidase -
  O9T43_RS03205 (O9T43_03205) - 665168..665518 (-) 351 WP_039187933.1 helix-turn-helix domain-containing protein -
  O9T43_RS03210 (O9T43_03210) - 665672..665869 (+) 198 WP_031641921.1 helix-turn-helix transcriptional regulator -
  O9T43_RS03215 (O9T43_03215) - 665892..666218 (+) 327 WP_039187936.1 DUF771 domain-containing protein -
  O9T43_RS03220 (O9T43_03220) - 666391..667350 (+) 960 WP_068998183.1 conserved phage C-terminal domain-containing protein -
  O9T43_RS03225 (O9T43_03225) - 667431..667787 (+) 357 WP_039188040.1 phage terminase small subunit-related protein -
  O9T43_RS03230 (O9T43_03230) - 667784..668200 (+) 417 WP_039188042.1 hypothetical protein -
  O9T43_RS03235 (O9T43_03235) - 668197..668373 (+) 177 WP_023552249.1 hypothetical protein -
  O9T43_RS03240 (O9T43_03240) - 668387..668911 (+) 525 WP_039188044.1 hypothetical protein -
  O9T43_RS03245 (O9T43_03245) - 668920..669384 (+) 465 WP_039188046.1 class I SAM-dependent methyltransferase -
  O9T43_RS03250 (O9T43_03250) - 669381..669941 (+) 561 WP_039194685.1 DUF1642 domain-containing protein -
  O9T43_RS03255 (O9T43_03255) - 670000..670401 (+) 402 WP_014601510.1 hypothetical protein -
  O9T43_RS03260 (O9T43_03260) - 670398..670607 (+) 210 WP_039194683.1 DUF7167 family protein -
  O9T43_RS03265 (O9T43_03265) - 670711..670890 (+) 180 WP_039194681.1 hypothetical protein -
  O9T43_RS03270 (O9T43_03270) ssbA 670887..671366 (+) 480 WP_039194679.1 single-stranded DNA-binding protein Machinery gene
  O9T43_RS03275 (O9T43_03275) - 671387..671626 (+) 240 WP_039187812.1 hypothetical protein -
  O9T43_RS03280 (O9T43_03280) - 671632..671802 (+) 171 WP_223196559.1 hypothetical protein -
  O9T43_RS03285 (O9T43_03285) - 671870..672391 (+) 522 WP_223196560.1 sigma factor-like helix-turn-helix DNA-binding protein -
  O9T43_RS03290 (O9T43_03290) - 672388..672930 (+) 543 WP_023552281.1 tyrosine-type recombinase/integrase -
  O9T43_RS03295 (O9T43_03295) - 672946..673284 (+) 339 WP_014930678.1 hypothetical protein -
  O9T43_RS03300 (O9T43_03300) - 673549..673875 (+) 327 WP_039187805.1 hypothetical protein -
  O9T43_RS14970 - 673872..674234 (+) 363 WP_052198696.1 HNH endonuclease signature motif containing protein -
  O9T43_RS03305 (O9T43_03305) - 674329..674856 (+) 528 WP_031668911.1 phage terminase small subunit P27 family -
  O9T43_RS03310 (O9T43_03310) - 674849..676576 (+) 1728 WP_031668912.1 terminase large subunit -
  O9T43_RS03315 (O9T43_03315) - 676583..676783 (+) 201 WP_023552290.1 DUF1056 family protein -
  O9T43_RS03320 (O9T43_03320) - 676786..678021 (+) 1236 WP_012951323.1 phage portal protein -
  O9T43_RS03325 (O9T43_03325) - 678018..678584 (+) 567 WP_012951324.1 HK97 family phage prohead protease -
  O9T43_RS03330 (O9T43_03330) - 678648..679817 (+) 1170 WP_012951325.1 phage major capsid protein -
  O9T43_RS03335 (O9T43_03335) - 679866..680204 (+) 339 WP_012951326.1 head-tail connector protein -
  O9T43_RS03340 (O9T43_03340) - 680174..680494 (+) 321 WP_012951327.1 phage head closure protein -
  O9T43_RS03345 (O9T43_03345) - 680488..680853 (+) 366 WP_031668913.1 HK97-gp10 family putative phage morphogenesis protein -
  O9T43_RS03350 (O9T43_03350) - 680856..681254 (+) 399 WP_012951329.1 hypothetical protein -
  O9T43_RS03355 (O9T43_03355) - 681275..681850 (+) 576 WP_012951330.1 major tail protein -
  O9T43_RS03360 (O9T43_03360) gpG 681940..682287 (+) 348 WP_012951331.1 phage tail assembly chaperone G -
  O9T43_RS03365 (O9T43_03365) - 682580..686683 (+) 4104 WP_226314767.1 phage tail tape measure protein -
  O9T43_RS03370 (O9T43_03370) - 686676..688919 (+) 2244 WP_014930683.1 distal tail protein Dit -
  O9T43_RS03375 (O9T43_03375) - 688925..691216 (+) 2292 WP_031668916.1 phage tail spike protein -
  O9T43_RS03380 (O9T43_03380) - 691209..692270 (+) 1062 WP_039194677.1 hypothetical protein -
  O9T43_RS03385 (O9T43_03385) - 692309..692674 (+) 366 WP_003722523.1 Gp23 family protein -
  O9T43_RS03390 (O9T43_03390) - 692687..692968 (+) 282 WP_003722522.1 holin -
  O9T43_RS03395 (O9T43_03395) - 692968..693813 (+) 846 WP_039194676.1 DUF5776 domain-containing protein -
  O9T43_RS03400 (O9T43_03400) acrIIA1 693887..694336 (-) 450 WP_031668927.1 anti-CRISPR protein AcrIIA1 -
  O9T43_RS03405 (O9T43_03405) acrIIA2 694341..694712 (-) 372 WP_031668925.1 anti-CRISPR protein AcrIIA2 -
  O9T43_RS03410 (O9T43_03410) acrIIA3 694746..695102 (-) 357 WP_223196561.1 anti-CRISPR protein AcrIIA3 -
  O9T43_RS14960 - 696837..697751 (+) 915 Protein_668 trypsin-like serine peptidase -
  O9T43_RS03430 (O9T43_03430) - 697751..698110 (+) 360 WP_003732618.1 lipoprotein -
  O9T43_RS14975 - 698220..698454 (+) 235 Protein_670 hypothetical protein -
  O9T43_RS03435 (O9T43_03435) - 698642..699175 (+) 534 WP_009924470.1 DUF3267 domain-containing protein -
  O9T43_RS03440 (O9T43_03440) - 699239..700156 (+) 918 WP_003722839.1 aldo/keto reductase -
  O9T43_RS03445 (O9T43_03445) - 700422..702302 (+) 1881 WP_020246485.1 heavy metal translocating P-type ATPase -
  O9T43_RS03450 (O9T43_03450) - 702398..703126 (+) 729 WP_009924467.1 hypothetical protein -
  O9T43_RS03455 (O9T43_03455) - 703269..703919 (+) 651 WP_003732614.1 transaldolase -
  O9T43_RS03460 (O9T43_03460) ltaP 703962..705782 (-) 1821 WP_077916961.1 lipoteichoic acid primase LtaP -
  O9T43_RS03465 (O9T43_03465) - 706017..707408 (+) 1392 WP_003732612.1 amino acid permease -
  O9T43_RS03470 (O9T43_03470) - 707498..708337 (+) 840 WP_009925348.1 VOC family protein -
  O9T43_RS03475 (O9T43_03475) - 708420..708704 (-) 285 WP_003721764.1 hypothetical protein -
  O9T43_RS03480 (O9T43_03480) - 708802..709752 (+) 951 WP_003721765.1 magnesium transporter CorA family protein -
  O9T43_RS03485 (O9T43_03485) - 709776..710417 (+) 642 WP_003721766.1 GntR family transcriptional regulator -
  O9T43_RS03490 (O9T43_03490) - 710460..713150 (+) 2691 WP_061724636.1 YhgE/Pip domain-containing protein -
  O9T43_RS03495 (O9T43_03495) - 713196..713843 (+) 648 WP_003721768.1 GntR family transcriptional regulator -
  O9T43_RS03500 (O9T43_03500) - 713852..714388 (-) 537 WP_009925176.1 GNAT family N-acetyltransferase -
  O9T43_RS03505 (O9T43_03505) - 714375..715295 (-) 921 WP_003733993.1 DUF975 family protein -
  O9T43_RS03510 (O9T43_03510) - 715486..715695 (+) 210 WP_003721771.1 Lmo0654 family protein -
  O9T43_RS03515 (O9T43_03515) - 715763..716470 (+) 708 WP_003729376.1 metallophosphoesterase family protein -
  O9T43_RS03520 (O9T43_03520) - 716514..717077 (-) 564 WP_003721773.1 DUF420 domain-containing protein -
  O9T43_RS03525 (O9T43_03525) - 717197..717613 (+) 417 WP_003721774.1 hypothetical protein -
  O9T43_RS03530 (O9T43_03530) - 717665..718300 (+) 636 WP_009925179.1 endonuclease III domain-containing protein -
  O9T43_RS03535 (O9T43_03535) - 718290..719186 (-) 897 WP_003721776.1 Rgg/GadR/MutR family transcriptional regulator -
  O9T43_RS03540 (O9T43_03540) - 719417..719701 (+) 285 WP_009931745.1 helix-turn-helix domain-containing protein -
  O9T43_RS03545 (O9T43_03545) - 719756..720064 (-) 309 WP_010989541.1 carboxymuconolactone decarboxylase family protein -
  O9T43_RS03550 (O9T43_03550) pdxK 720127..720942 (-) 816 WP_003721779.1 pyridoxine/pyridoxal/pyridoxamine kinase -
  O9T43_RS03555 (O9T43_03555) - 720968..721834 (-) 867 WP_003721781.1 Cof-type HAD-IIB family hydrolase -
  O9T43_RS03560 (O9T43_03560) - 722008..722571 (+) 564 WP_003721782.1 maltose acetyltransferase domain-containing protein -
  O9T43_RS03565 (O9T43_03565) - 722568..722831 (+) 264 WP_003721783.1 DUF5327 family protein -
  O9T43_RS03570 (O9T43_03570) - 722841..723218 (+) 378 WP_009924834.1 DUF423 domain-containing protein -
  O9T43_RS03575 (O9T43_03575) - 723332..724267 (+) 936 WP_003721785.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 159 a.a.        Molecular weight: 17470.42 Da        Isoelectric Point: 5.2753

>NTDB_id=768035 O9T43_RS03270 WP_039194679.1 670887..671366(+) (ssbA) [Listeria monocytogenes strain MKELm2_2022]
MMNRVVLVGRLTKDPELRYTPAGVAVATFTLAVNRAFTNQNGEREADFINCVVWRKPAENVANFLKKGSMAGVDGRVQTR
NYEDGDGKRVFVTEVVAESVQFLEPKNNPGRAATNDYQNKANYSNNIQTSSYAADASQKGGAFVNDSKPIDIPDDDLSF

Nucleotide


Download         Length: 480 bp        

>NTDB_id=768035 O9T43_RS03270 WP_039194679.1 670887..671366(+) (ssbA) [Listeria monocytogenes strain MKELm2_2022]
ATGATGAATCGTGTAGTACTTGTAGGACGCTTAACAAAAGACCCTGAATTACGTTACACTCCAGCAGGCGTAGCAGTCGC
GACTTTTACATTAGCTGTAAACCGCGCTTTCACTAATCAGAATGGAGAACGAGAAGCCGACTTTATAAATTGTGTTGTTT
GGCGTAAACCAGCGGAAAACGTTGCTAATTTCTTGAAGAAAGGAAGCATGGCAGGCGTTGATGGACGCGTACAGACTCGT
AATTATGAGGACGGCGACGGTAAACGTGTTTTCGTTACGGAAGTAGTTGCTGAATCAGTTCAATTCTTAGAACCTAAAAA
CAACCCAGGAAGAGCTGCAACAAATGATTATCAAAACAAAGCTAATTATTCAAACAACATCCAAACAAGCTCATATGCAG
CGGATGCGAGTCAGAAAGGCGGTGCATTTGTTAATGATAGCAAGCCAATCGATATTCCAGATGATGATTTATCGTTTTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A467HC69

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

62.921

100

0.704

  ssb Latilactobacillus sakei subsp. sakei 23K

53.757

100

0.585

  ssbB Bacillus subtilis subsp. subtilis str. 168

62.264

66.667

0.415

  ssb Neisseria meningitidis MC58

33.333

100

0.365