Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | IB222_RS21475 | Genome accession | NZ_CP115024 |
| Coordinates | 4487215..4487739 (-) | Length | 174 a.a. |
| NCBI ID | WP_003826621.1 | Uniprot ID | A0A5B0T4S2 |
| Organism | Citrobacter sp. C13 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 4399128..4508176 | 4487215..4487739 | within | 0 |
Gene organization within MGE regions
Location: 4399128..4508176
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| IB222_RS21100 (IB222_021080) | - | 4405165..4406796 (+) | 1632 | WP_003826772.1 | sensor histidine kinase | - |
| IB222_RS21105 (IB222_021085) | dcuR | 4406793..4407512 (+) | 720 | WP_008786975.1 | two-component system response regulator DcuR | - |
| IB222_RS21110 (IB222_021090) | dcuB | 4408228..4409568 (+) | 1341 | WP_003031873.1 | anaerobic C4-dicarboxylate transporter DcuB | - |
| IB222_RS21115 (IB222_021095) | fumA | 4409665..4411311 (+) | 1647 | WP_057068411.1 | class I fumarate hydratase FumA | - |
| IB222_RS21120 (IB222_021100) | - | 4411459..4412082 (+) | 624 | WP_032934135.1 | DUF2238 domain-containing protein | - |
| IB222_RS21125 (IB222_021105) | - | 4412103..4412357 (-) | 255 | WP_079939016.1 | SemiSWEET transporter | - |
| IB222_RS21130 (IB222_021110) | melB | 4412360..4413790 (-) | 1431 | WP_079939015.1 | melibiose:sodium transporter MelB | - |
| IB222_RS21135 (IB222_021115) | melA | 4413883..4415238 (-) | 1356 | WP_149385122.1 | alpha-galactosidase | - |
| IB222_RS21140 (IB222_021120) | melR | 4415508..4416440 (+) | 933 | WP_003826756.1 | transcriptional regulator MelR | - |
| IB222_RS21145 (IB222_021125) | adiA | 4416678..4418945 (+) | 2268 | WP_148362704.1 | arginine decarboxylase | - |
| IB222_RS21150 (IB222_021130) | - | 4419260..4420021 (+) | 762 | WP_008786968.1 | AraC family transcriptional regulator | - |
| IB222_RS21155 (IB222_021135) | adiC | 4420149..4421486 (+) | 1338 | WP_003031853.1 | arginine/agmatine antiporter | - |
| IB222_RS21160 (IB222_021140) | eptA | 4421633..4423270 (+) | 1638 | WP_149385123.1 | phosphoethanolamine transferase EptA | - |
| IB222_RS21165 (IB222_021145) | pmrA | 4423275..4423943 (+) | 669 | WP_003826748.1 | two-component system response regulator PmrA | - |
| IB222_RS21170 (IB222_021150) | pmrB | 4423953..4425026 (+) | 1074 | WP_126957405.1 | two-component system sensor histidine kinase PmrB | - |
| IB222_RS21175 | pmrR | 4425020..4425109 (-) | 90 | WP_003826741.1 | LpxT activity modulator PmrR | - |
| IB222_RS21180 (IB222_021155) | proP | 4425996..4427498 (-) | 1503 | WP_003826737.1 | glycine betaine/L-proline transporter ProP | - |
| IB222_RS21185 (IB222_021160) | kdgT | 4428198..4429196 (+) | 999 | WP_003826735.1 | 2-keto-3-deoxygluconate transporter | - |
| IB222_RS21190 (IB222_021165) | - | 4429227..4430120 (-) | 894 | WP_148362552.1 | diguanylate cyclase regulator RdcB family protein | - |
| IB222_RS21195 (IB222_021170) | crfC | 4430117..4432474 (-) | 2358 | WP_003826731.1 | clamp-binding protein CrfC | - |
| IB222_RS21200 (IB222_021175) | - | 4433015..4433350 (+) | 336 | WP_003031835.1 | zinc ribbon domain-containing protein YjdM | - |
| IB222_RS21205 (IB222_021180) | yjdN | 4433490..4433939 (+) | 450 | WP_003031832.1 | VOC family metalloprotein YjdN | - |
| IB222_RS21210 (IB222_021185) | phnC | 4434072..4434860 (+) | 789 | WP_149385127.1 | phosphonate ABC transporter ATP-binding protein | - |
| IB222_RS21215 (IB222_021190) | phnD | 4434884..4435900 (+) | 1017 | WP_003826724.1 | phosphonate ABC transporter substrate-binding protein | - |
| IB222_RS21220 (IB222_021195) | phnE | 4436034..4436813 (+) | 780 | WP_016155398.1 | phosphonate ABC transporter, permease protein PhnE | - |
| IB222_RS21225 (IB222_021200) | phnF | 4436834..4437559 (+) | 726 | WP_063941252.1 | phosphonate metabolism transcriptional regulator PhnF | - |
| IB222_RS21230 (IB222_021205) | phnG | 4437560..4438012 (+) | 453 | WP_003826718.1 | phosphonate C-P lyase system protein PhnG | - |
| IB222_RS21235 (IB222_021210) | phnH | 4438009..4438593 (+) | 585 | WP_003826715.1 | phosphonate C-P lyase system protein PhnH | - |
| IB222_RS21240 (IB222_021215) | - | 4438593..4439660 (+) | 1068 | WP_148362555.1 | carbon-phosphorus lyase complex subunit PhnI | - |
| IB222_RS21245 (IB222_021220) | phnJ | 4439707..4440498 (+) | 792 | WP_224774781.1 | alpha-D-ribose 1-methylphosphonate 5-phosphate C-P-lyase PhnJ | - |
| IB222_RS21250 (IB222_021225) | phnK | 4440495..4441253 (+) | 759 | WP_003826710.1 | phosphonate C-P lyase system protein PhnK | - |
| IB222_RS21255 (IB222_021230) | phnL | 4441472..4442158 (+) | 687 | WP_063941249.1 | phosphonate C-P lyase system protein PhnL | - |
| IB222_RS21260 (IB222_021235) | phnM | 4442155..4443291 (+) | 1137 | WP_126319496.1 | alpha-D-ribose 1-methylphosphonate 5-triphosphate diphosphatase | - |
| IB222_RS21265 (IB222_021240) | phnN | 4443294..4443848 (+) | 555 | WP_008786953.1 | ribose 1,5-bisphosphokinase | - |
| IB222_RS21270 (IB222_021245) | phnO | 4443835..4444269 (+) | 435 | WP_126319498.1 | aminoalkylphosphonate N-acetyltransferase | - |
| IB222_RS21275 (IB222_021250) | phnP | 4444278..4445036 (+) | 759 | WP_148362557.1 | phosphonate metabolism protein PhnP | - |
| IB222_RS21280 (IB222_021255) | - | 4445089..4445430 (-) | 342 | WP_008786950.1 | HigA family addiction module antitoxin | - |
| IB222_RS21285 (IB222_021260) | - | 4445451..4445711 (-) | 261 | WP_348925957.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| IB222_RS21290 | - | 4445623..4445814 (-) | 192 | WP_348925512.1 | hypothetical protein | - |
| IB222_RS21295 (IB222_021265) | - | 4445796..4446776 (-) | 981 | WP_000019448.1 | IS5-like element ISKpn26 family transposase | - |
| IB222_RS21300 (IB222_021270) | yjdP | 4447109..4447438 (-) | 330 | WP_003031807.1 | DDRRRQL repeat protein YjdP | - |
| IB222_RS21305 (IB222_021275) | - | 4447508..4449772 (-) | 2265 | WP_149385229.1 | hybrid sensor histidine kinase/response regulator | - |
| IB222_RS21310 (IB222_021280) | - | 4449887..4451410 (+) | 1524 | WP_149335872.1 | sugar ABC transporter ATP-binding protein | - |
| IB222_RS21315 (IB222_021285) | - | 4451403..4452398 (+) | 996 | WP_063941242.1 | ribose ABC transporter permease | - |
| IB222_RS21320 (IB222_021290) | - | 4452487..4453428 (+) | 942 | WP_003826688.1 | ABC transporter substrate-binding protein | - |
| IB222_RS21325 (IB222_021295) | - | 4453549..4454232 (+) | 684 | WP_149385230.1 | D-lyxose/D-mannose family sugar isomerase | - |
| IB222_RS21330 (IB222_021300) | - | 4454247..4455107 (+) | 861 | WP_149385231.1 | ketose 1,6-bisphosphate aldolase | - |
| IB222_RS21335 (IB222_021305) | - | 4455104..4456108 (+) | 1005 | WP_149385232.1 | carbohydrate kinase family protein | - |
| IB222_RS21340 (IB222_021310) | - | 4456263..4456994 (-) | 732 | WP_003826666.1 | response regulator transcription factor | - |
| IB222_RS21345 (IB222_021315) | - | 4457023..4457187 (+) | 165 | WP_008786941.1 | hypothetical protein | - |
| IB222_RS21350 (IB222_021320) | fdhF | 4457283..4459430 (+) | 2148 | WP_081003612.1 | formate dehydrogenase subunit alpha | - |
| IB222_RS21355 (IB222_021325) | yjcO | 4459522..4460205 (+) | 684 | WP_149385233.1 | Sel1 family TPR-like repeat protein YjcO | - |
| IB222_RS21360 (IB222_021330) | gltP | 4460284..4461594 (-) | 1311 | WP_003826659.1 | glutamate/aspartate:proton symporter GltP | - |
| IB222_RS21365 (IB222_021335) | nrfG | 4461939..4462550 (-) | 612 | WP_149385234.1 | heme lyase NrfEFG subunit NrfG | - |
| IB222_RS21370 (IB222_021340) | nrfF | 4462547..4464776 (-) | 2230 | Protein_4187 | heme lyase NrfEFG subunit NrfF | - |
| IB222_RS21375 (IB222_021345) | nrfD | 4464785..4465741 (-) | 957 | WP_003826653.1 | cytochrome c nitrite reductase subunit NrfD | - |
| IB222_RS21380 (IB222_021350) | nrfC | 4465738..4466409 (-) | 672 | WP_149385236.1 | cytochrome c nitrite reductase Fe-S protein | - |
| IB222_RS21385 (IB222_021355) | nrfB | 4466406..4466972 (-) | 567 | WP_003826649.1 | cytochrome c nitrite reductase pentaheme subunit | - |
| IB222_RS21390 (IB222_021360) | nrfA | 4467017..4468453 (-) | 1437 | WP_148362565.1 | ammonia-forming nitrite reductase cytochrome c552 subunit | - |
| IB222_RS21395 (IB222_021365) | acs | 4468888..4470846 (+) | 1959 | WP_149385237.1 | acetate--CoA ligase | - |
| IB222_RS21400 (IB222_021370) | - | 4471033..4471347 (+) | 315 | WP_006688274.1 | DUF485 domain-containing protein | - |
| IB222_RS21405 (IB222_021375) | actP | 4471344..4472993 (+) | 1650 | WP_003826641.1 | cation/acetate symporter ActP | - |
| IB222_RS21410 (IB222_021380) | - | 4473039..4473728 (-) | 690 | WP_003031745.1 | LrgB family protein | - |
| IB222_RS21415 (IB222_021385) | - | 4473721..4474131 (-) | 411 | WP_003826638.1 | CidA/LrgA family protein | - |
| IB222_RS21420 (IB222_021390) | - | 4474233..4475123 (+) | 891 | WP_003826636.1 | LysR family transcriptional regulator | - |
| IB222_RS21425 (IB222_021395) | - | 4475183..4475617 (-) | 435 | WP_223240925.1 | transposase | - |
| IB222_RS21430 (IB222_021400) | - | 4476161..4477807 (-) | 1647 | WP_149385238.1 | Na+/H+ antiporter | - |
| IB222_RS21435 (IB222_021405) | ghxP | 4477965..4479314 (-) | 1350 | WP_003826632.1 | guanine/hypoxanthine transporter GhxP | - |
| IB222_RS21440 (IB222_021410) | soxR | 4479923..4480381 (-) | 459 | WP_043018085.1 | redox-sensitive transcriptional activator SoxR | - |
| IB222_RS21445 (IB222_021415) | soxS | 4480468..4480791 (+) | 324 | WP_003031731.1 | superoxide response transcriptional regulator SoxS | - |
| IB222_RS21450 (IB222_021420) | - | 4480794..4482380 (-) | 1587 | WP_149385239.1 | EAL domain-containing protein | - |
| IB222_RS21455 (IB222_021425) | - | 4482933..4483214 (+) | 282 | WP_003826625.1 | YjcB family protein | - |
| IB222_RS21460 (IB222_021430) | - | 4483296..4483898 (-) | 603 | Protein_4205 | autotransporter outer membrane beta-barrel domain-containing protein | - |
| IB222_RS21470 (IB222_021440) | - | 4485110..4486837 (-) | 1728 | WP_223240897.1 | autotransporter outer membrane beta-barrel domain-containing protein | - |
| IB222_RS21475 (IB222_021445) | ssb | 4487215..4487739 (-) | 525 | WP_003826621.1 | single-stranded DNA-binding protein SSB1 | Machinery gene |
| IB222_RS21480 (IB222_021450) | uvrA | 4487991..4490813 (+) | 2823 | WP_003826619.1 | excinuclease ABC subunit UvrA | - |
| IB222_RS21485 (IB222_021455) | - | 4491397..4491753 (-) | 357 | WP_148362570.1 | MmcQ/YjbR family DNA-binding protein | - |
| IB222_RS21490 (IB222_021460) | aphA | 4491881..4492594 (-) | 714 | WP_003826615.1 | acid phosphatase AphA | - |
| IB222_RS21495 (IB222_021465) | tyrB | 4492779..4493972 (-) | 1194 | WP_003826614.1 | aromatic amino acid transaminase | - |
| IB222_RS21500 (IB222_021470) | alr | 4494101..4495180 (-) | 1080 | WP_003826612.1 | alanine racemase | - |
| IB222_RS21505 (IB222_021475) | dnaB | 4495326..4496741 (-) | 1416 | WP_003826610.1 | replicative DNA helicase | - |
| IB222_RS21510 (IB222_021480) | - | 4496806..4497789 (+) | 984 | WP_003826608.1 | quinone oxidoreductase | - |
| IB222_RS21515 (IB222_021485) | pspG | 4498092..4498334 (-) | 243 | WP_003031713.1 | envelope stress response protein PspG | - |
| IB222_RS21520 (IB222_021490) | dusA | 4498468..4499466 (-) | 999 | WP_003826604.1 | tRNA dihydrouridine(20/20a) synthase DusA | - |
| IB222_RS21525 (IB222_021495) | - | 4499574..4500062 (-) | 489 | WP_003031710.1 | cupin domain-containing protein | - |
| IB222_RS21530 (IB222_021500) | zur | 4500178..4500696 (+) | 519 | WP_003031709.1 | zinc uptake transcriptional repressor Zur | - |
| IB222_RS21535 (IB222_021505) | - | 4500745..4500954 (-) | 210 | WP_003031706.1 | CsbD family protein | - |
| IB222_RS21540 (IB222_021510) | dinF | 4501091..4502410 (-) | 1320 | WP_149385018.1 | MATE family efflux transporter DinF | - |
| IB222_RS21545 (IB222_021515) | lexA | 4502542..4503150 (-) | 609 | WP_003826596.1 | transcriptional repressor LexA | - |
| IB222_RS21550 (IB222_021520) | - | 4503260..4503628 (-) | 369 | WP_003826594.1 | diacylglycerol kinase | - |
| IB222_RS21555 (IB222_021525) | plsB | 4503799..4506219 (+) | 2421 | WP_003826592.1 | glycerol-3-phosphate 1-O-acyltransferase PlsB | - |
| IB222_RS21560 (IB222_021530) | ubiA | 4506326..4507198 (-) | 873 | WP_003826589.1 | 4-hydroxybenzoate octaprenyltransferase | - |
| IB222_RS21565 (IB222_021535) | ubiC | 4507212..4507709 (-) | 498 | WP_003826587.1 | chorismate lyase | - |
Sequence
Protein
Download Length: 174 a.a. Molecular weight: 18621.66 Da Isoelectric Point: 5.2456
>NTDB_id=767896 IB222_RS21475 WP_003826621.1 4487215..4487739(-) (ssb) [Citrobacter sp. C13]
MASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYI
EGQLRTRKWTDQSGVEKYTTEVVVNVGGTMQMLGGRQGGGAPAGGGQQQGGWGQPQQPQGGNQFSGGAQSRPQQSAPAAP
SNEPPMDFDDDIPF
MASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYI
EGQLRTRKWTDQSGVEKYTTEVVVNVGGTMQMLGGRQGGGAPAGGGQQQGGWGQPQQPQGGNQFSGGAQSRPQQSAPAAP
SNEPPMDFDDDIPF
Nucleotide
Download Length: 525 bp
>NTDB_id=767896 IB222_RS21475 WP_003826621.1 4487215..4487739(-) (ssb) [Citrobacter sp. C13]
ATGGCCAGCAGAGGCGTAAACAAGGTGATTCTCGTCGGTAATCTGGGCCAGGACCCGGAAGTACGCTATATGCCGAATGG
TGGCGCAGTTGCCAACATTACGCTGGCTACTTCCGAATCCTGGCGTGATAAAGCGACCGGTGAAATGAAAGAGCAGACTG
AATGGCACCGTGTTGTGCTGTTTGGCAAACTGGCGGAAGTGGCCAGCGAATATCTGCGTAAAGGTTCTCAGGTCTATATC
GAAGGTCAGTTGCGTACCCGCAAATGGACCGATCAGTCCGGCGTAGAAAAGTACACCACAGAAGTTGTGGTTAACGTTGG
CGGCACCATGCAAATGCTGGGTGGTCGTCAGGGTGGTGGTGCTCCGGCAGGTGGCGGTCAGCAGCAGGGCGGTTGGGGTC
AACCTCAGCAGCCGCAGGGTGGCAACCAGTTCAGCGGCGGCGCGCAGTCTCGTCCGCAACAGTCAGCTCCGGCTGCGCCG
TCTAACGAGCCGCCGATGGATTTCGACGACGATATTCCGTTCTAA
ATGGCCAGCAGAGGCGTAAACAAGGTGATTCTCGTCGGTAATCTGGGCCAGGACCCGGAAGTACGCTATATGCCGAATGG
TGGCGCAGTTGCCAACATTACGCTGGCTACTTCCGAATCCTGGCGTGATAAAGCGACCGGTGAAATGAAAGAGCAGACTG
AATGGCACCGTGTTGTGCTGTTTGGCAAACTGGCGGAAGTGGCCAGCGAATATCTGCGTAAAGGTTCTCAGGTCTATATC
GAAGGTCAGTTGCGTACCCGCAAATGGACCGATCAGTCCGGCGTAGAAAAGTACACCACAGAAGTTGTGGTTAACGTTGG
CGGCACCATGCAAATGCTGGGTGGTCGTCAGGGTGGTGGTGCTCCGGCAGGTGGCGGTCAGCAGCAGGGCGGTTGGGGTC
AACCTCAGCAGCCGCAGGGTGGCAACCAGTTCAGCGGCGGCGCGCAGTCTCGTCCGCAACAGTCAGCTCCGGCTGCGCCG
TCTAACGAGCCGCCGATGGATTTCGACGACGATATTCCGTTCTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Vibrio cholerae strain A1552 |
73.889 |
100 |
0.764 |
| ssb | Glaesserella parasuis strain SC1401 |
56.831 |
100 |
0.598 |
| ssb | Neisseria meningitidis MC58 |
48.603 |
100 |
0.5 |
| ssb | Neisseria gonorrhoeae MS11 |
48.603 |
100 |
0.5 |