Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   O6U12_RS04700 Genome accession   NZ_CP114899
Coordinates   865533..865706 (-) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 860533..870706
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  O6U12_RS04655 (O6U12_04655) comGE 860890..861237 (+) 348 WP_017696195.1 competence type IV pilus minor pilin ComGE Machinery gene
  O6U12_RS04660 (O6U12_04660) comGF 861263..861646 (+) 384 WP_017696196.1 ComG operon protein ComGF Machinery gene
  O6U12_RS04665 (O6U12_04665) comGG 861647..862021 (+) 375 WP_017696197.1 ComG operon protein ComGG Machinery gene
  O6U12_RS04670 (O6U12_04670) spoIITA 862092..862271 (+) 180 WP_014480252.1 YqzE family protein -
  O6U12_RS04675 (O6U12_04675) yqzG 862313..862639 (-) 327 WP_026113671.1 YqzG/YhdC family protein -
  O6U12_RS04680 (O6U12_04680) tapA 862910..863665 (+) 756 WP_017696199.1 amyloid fiber anchoring/assembly protein TapA -
  O6U12_RS04685 (O6U12_04685) sipW 863649..864221 (+) 573 WP_080031082.1 signal peptidase I SipW -
  O6U12_RS04690 (O6U12_04690) tasA 864286..865071 (+) 786 WP_017696201.1 biofilm matrix protein TasA -
  O6U12_RS04695 (O6U12_04695) sinR 865164..865499 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  O6U12_RS04700 (O6U12_04700) sinI 865533..865706 (-) 174 WP_003230187.1 anti-repressor SinI Regulator
  O6U12_RS04705 (O6U12_04705) yqhG 865889..866683 (-) 795 WP_017696202.1 YqhG family protein -
  O6U12_RS04710 (O6U12_04710) hepAA 866704..868377 (-) 1674 WP_017696203.1 DEAD/DEAH box helicase -
  O6U12_RS04715 (O6U12_04715) gcvT 868818..869906 (+) 1089 WP_017696204.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=767579 O6U12_RS04700 WP_003230187.1 865533..865706(-) (sinI) [Bacillus subtilis strain]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=767579 O6U12_RS04700 WP_003230187.1 865533..865706(-) (sinI) [Bacillus subtilis strain]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1