Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   O6U12_RS04665 Genome accession   NZ_CP114899
Coordinates   861647..862021 (+) Length   124 a.a.
NCBI ID   WP_017696197.1    Uniprot ID   -
Organism   Bacillus subtilis strain     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 856647..867021
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  O6U12_RS04630 (O6U12_04630) corA 856718..857671 (+) 954 WP_017696189.1 magnesium transporter CorA -
  O6U12_RS04635 (O6U12_04635) comGA 858081..859151 (+) 1071 WP_017696192.1 competence protein ComGA Machinery gene
  O6U12_RS04640 (O6U12_04640) comGB 859138..860175 (+) 1038 WP_017696193.1 competence type IV pilus assembly protein ComGB Machinery gene
  O6U12_RS04645 (O6U12_04645) comGC 860189..860485 (+) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  O6U12_RS04650 (O6U12_04650) comGD 860475..860906 (+) 432 WP_017696194.1 competence type IV pilus minor pilin ComGD Machinery gene
  O6U12_RS04655 (O6U12_04655) comGE 860890..861237 (+) 348 WP_017696195.1 competence type IV pilus minor pilin ComGE Machinery gene
  O6U12_RS04660 (O6U12_04660) comGF 861263..861646 (+) 384 WP_017696196.1 ComG operon protein ComGF Machinery gene
  O6U12_RS04665 (O6U12_04665) comGG 861647..862021 (+) 375 WP_017696197.1 ComG operon protein ComGG Machinery gene
  O6U12_RS04670 (O6U12_04670) spoIITA 862092..862271 (+) 180 WP_014480252.1 YqzE family protein -
  O6U12_RS04675 (O6U12_04675) yqzG 862313..862639 (-) 327 WP_026113671.1 YqzG/YhdC family protein -
  O6U12_RS04680 (O6U12_04680) tapA 862910..863665 (+) 756 WP_017696199.1 amyloid fiber anchoring/assembly protein TapA -
  O6U12_RS04685 (O6U12_04685) sipW 863649..864221 (+) 573 WP_080031082.1 signal peptidase I SipW -
  O6U12_RS04690 (O6U12_04690) tasA 864286..865071 (+) 786 WP_017696201.1 biofilm matrix protein TasA -
  O6U12_RS04695 (O6U12_04695) sinR 865164..865499 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  O6U12_RS04700 (O6U12_04700) sinI 865533..865706 (-) 174 WP_003230187.1 anti-repressor SinI Regulator
  O6U12_RS04705 (O6U12_04705) yqhG 865889..866683 (-) 795 WP_017696202.1 YqhG family protein -

Sequence

Protein


Download         Length: 124 a.a.        Molecular weight: 14526.75 Da        Isoelectric Point: 9.7778

>NTDB_id=767577 O6U12_RS04665 WP_017696197.1 861647..862021(+) (comGG) [Bacillus subtilis strain]
MYRTRGFIYPAVLFVSALVLLIVNFASAQYISRCMFEKETKELYIGENLLQNGTLLSIRHVLEKRKGQEGTQQFPYGRVS
YYIHDTSIKEQKEINLRVSTESGTERTAQIVFDQKQKKLLRWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=767577 O6U12_RS04665 WP_017696197.1 861647..862021(+) (comGG) [Bacillus subtilis strain]
ATGTATCGTACAAGAGGGTTTATTTATCCAGCTGTTCTTTTTGTGTCAGCGCTTGTACTGTTAATCGTGAACTTTGCTTC
TGCTCAATATATTTCACGCTGCATGTTTGAGAAGGAAACAAAAGAGTTATACATAGGAGAGAATTTGCTTCAAAATGGTA
CGCTTCTTTCGATTCGGCACGTTCTAGAGAAACGGAAAGGCCAGGAGGGTACGCAGCAATTTCCATATGGACGGGTTTCT
TATTACATTCATGATACATCGATAAAAGAACAAAAAGAAATCAACTTAAGAGTGTCAACGGAGTCGGGAACAGAAAGAAC
TGCACAGATCGTGTTTGATCAAAAACAGAAAAAGCTGCTGAGATGGACAGAATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

95.161

100

0.952