Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssbA   Type   Machinery gene
Locus tag   O4N14_RS09505 Genome accession   NZ_CP114763
Coordinates   1973566..1973994 (-) Length   142 a.a.
NCBI ID   WP_043852903.1    Uniprot ID   -
Organism   Clostridium butyricum strain LV1     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1943127..1983733 1973566..1973994 within 0


Gene organization within MGE regions


Location: 1943127..1983733
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  O4N14_RS09300 (O4N14_09300) - 1943127..1945151 (-) 2025 WP_052501798.1 ATP-binding protein -
  O4N14_RS09305 (O4N14_09305) - 1945458..1946078 (-) 621 WP_043852945.1 Ltp family lipoprotein -
  O4N14_RS09310 (O4N14_09310) - 1946350..1947069 (-) 720 WP_043852944.1 cell wall-binding protein -
  O4N14_RS09315 (O4N14_09315) - 1947250..1948179 (-) 930 WP_241393276.1 N-acetylmuramoyl-L-alanine amidase -
  O4N14_RS09320 (O4N14_09320) - 1948244..1948534 (-) 291 WP_035762713.1 phage holin family protein -
  O4N14_RS09325 (O4N14_09325) - 1948551..1948826 (-) 276 WP_043852942.1 hypothetical protein -
  O4N14_RS09330 (O4N14_09330) - 1948936..1949691 (-) 756 WP_043852941.1 DNA adenine methylase -
  O4N14_RS09335 (O4N14_09335) - 1949739..1949948 (-) 210 WP_043852940.1 hypothetical protein -
  O4N14_RS09340 (O4N14_09340) - 1950039..1950224 (-) 186 WP_003432434.1 hypothetical protein -
  O4N14_RS09345 (O4N14_09345) - 1950240..1950533 (-) 294 WP_043852938.1 hypothetical protein -
  O4N14_RS09350 (O4N14_09350) - 1950550..1951935 (-) 1386 WP_052501797.1 phage tail protein -
  O4N14_RS09355 (O4N14_09355) - 1951939..1952592 (-) 654 WP_043852936.1 phage tail protein I -
  O4N14_RS09360 (O4N14_09360) - 1952592..1953746 (-) 1155 WP_043852935.1 baseplate J/gp47 family protein -
  O4N14_RS09365 (O4N14_09365) - 1953736..1954053 (-) 318 WP_043852933.1 hypothetical protein -
  O4N14_RS09370 (O4N14_09370) - 1954059..1954616 (-) 558 WP_043852932.1 phage tail protein -
  O4N14_RS09375 (O4N14_09375) - 1954616..1954858 (-) 243 WP_043852930.1 hypothetical protein -
  O4N14_RS09380 (O4N14_09380) - 1954858..1955766 (-) 909 WP_224134112.1 hypothetical protein -
  O4N14_RS09385 (O4N14_09385) - 1955775..1955987 (-) 213 WP_052501796.1 tail protein X -
  O4N14_RS09390 (O4N14_09390) - 1955980..1958178 (-) 2199 WP_043852927.1 hypothetical protein -
  O4N14_RS09395 (O4N14_09395) - 1958342..1958692 (-) 351 WP_043852926.1 phage tail assembly protein -
  O4N14_RS09400 (O4N14_09400) - 1958757..1959287 (-) 531 WP_043852925.1 phage major tail tube protein -
  O4N14_RS09405 (O4N14_09405) - 1959287..1960726 (-) 1440 WP_043852924.1 hypothetical protein -
  O4N14_RS09410 (O4N14_09410) - 1960739..1961293 (-) 555 WP_043852923.1 hypothetical protein -
  O4N14_RS09415 (O4N14_09415) - 1961307..1961876 (-) 570 WP_043852922.1 phage tail protein -
  O4N14_RS09420 (O4N14_09420) - 1961876..1962199 (-) 324 WP_043852921.1 hypothetical protein -
  O4N14_RS09425 (O4N14_09425) - 1962196..1962546 (-) 351 WP_043852919.1 hypothetical protein -
  O4N14_RS09430 (O4N14_09430) - 1962557..1962889 (-) 333 WP_043852917.1 DUF2190 family protein -
  O4N14_RS09435 (O4N14_09435) - 1962908..1964416 (-) 1509 WP_043852916.1 hypothetical protein -
  O4N14_RS09440 (O4N14_09440) - 1964418..1965035 (-) 618 WP_043852915.1 HK97 family phage prohead protease -
  O4N14_RS09445 (O4N14_09445) - 1965022..1966497 (-) 1476 WP_043852914.1 phage portal protein -
  O4N14_RS09450 (O4N14_09450) - 1966507..1966734 (-) 228 WP_043852913.1 hypothetical protein -
  O4N14_RS09455 (O4N14_09455) - 1966749..1968590 (-) 1842 WP_043852912.1 terminase gpA endonuclease subunit -
  O4N14_RS09460 (O4N14_09460) - 1968613..1969119 (-) 507 WP_043852911.1 hypothetical protein -
  O4N14_RS09465 (O4N14_09465) - 1969299..1969511 (-) 213 WP_043852910.1 hypothetical protein -
  O4N14_RS09470 (O4N14_09470) - 1969676..1970248 (-) 573 WP_043852909.1 hypothetical protein -
  O4N14_RS09475 (O4N14_09475) - 1970241..1970612 (-) 372 WP_043852908.1 hypothetical protein -
  O4N14_RS09480 (O4N14_09480) - 1970939..1971511 (-) 573 WP_043852907.1 hypothetical protein -
  O4N14_RS09485 (O4N14_09485) - 1971979..1972599 (-) 621 WP_043852906.1 HEPN domain-containing protein -
  O4N14_RS09490 (O4N14_09490) - 1972850..1973017 (-) 168 WP_169512799.1 hypothetical protein -
  O4N14_RS09495 (O4N14_09495) - 1973004..1973150 (-) 147 WP_080775794.1 aspartyl-phosphate phosphatase Spo0E family protein -
  O4N14_RS09500 (O4N14_09500) - 1973206..1973550 (-) 345 WP_043852904.1 hypothetical protein -
  O4N14_RS09505 (O4N14_09505) ssbA 1973566..1973994 (-) 429 WP_043852903.1 single-stranded DNA-binding protein Machinery gene
  O4N14_RS09510 (O4N14_09510) - 1974078..1975085 (-) 1008 WP_043852902.1 ParB/RepB/Spo0J family partition protein -
  O4N14_RS09515 (O4N14_09515) - 1975089..1975865 (-) 777 WP_043852900.1 ParA family protein -
  O4N14_RS09520 (O4N14_09520) - 1975912..1976070 (-) 159 WP_043852898.1 hypothetical protein -
  O4N14_RS09525 (O4N14_09525) - 1976098..1976472 (-) 375 WP_043852896.1 VRR-NUC domain-containing protein -
  O4N14_RS09530 (O4N14_09530) - 1976469..1977368 (-) 900 WP_043852895.1 rolling circle replication-associated protein -
  O4N14_RS09535 (O4N14_09535) - 1977577..1978098 (-) 522 WP_043852894.1 hypothetical protein -
  O4N14_RS09540 (O4N14_09540) - 1978118..1978363 (-) 246 WP_043852893.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
  O4N14_RS09545 (O4N14_09545) - 1978386..1978553 (-) 168 WP_155394927.1 hypothetical protein -
  O4N14_RS09550 (O4N14_09550) - 1978813..1979028 (-) 216 WP_043852892.1 hypothetical protein -
  O4N14_RS09555 (O4N14_09555) - 1979112..1979303 (+) 192 WP_043852891.1 hypothetical protein -
  O4N14_RS09560 (O4N14_09560) - 1979257..1979565 (-) 309 WP_043852890.1 hypothetical protein -
  O4N14_RS09565 (O4N14_09565) - 1979566..1979715 (-) 150 WP_155394926.1 hypothetical protein -
  O4N14_RS09570 (O4N14_09570) - 1979996..1980499 (+) 504 WP_043853543.1 helix-turn-helix domain-containing protein -
  O4N14_RS09575 (O4N14_09575) - 1980527..1980712 (+) 186 WP_043852889.1 hypothetical protein -
  O4N14_RS09580 (O4N14_09580) - 1980809..1981012 (+) 204 WP_052501794.1 DUF2442 domain-containing protein -
  O4N14_RS09585 (O4N14_09585) - 1981033..1981611 (+) 579 WP_043852888.1 Uma2 family endonuclease -
  O4N14_RS09590 (O4N14_09590) - 1981645..1982013 (+) 369 WP_043852887.1 hypothetical protein -
  O4N14_RS09595 (O4N14_09595) - 1982078..1983733 (+) 1656 WP_043852885.1 recombinase family protein -

Sequence

Protein


Download         Length: 142 a.a.        Molecular weight: 15509.28 Da        Isoelectric Point: 4.5423

>NTDB_id=766976 O4N14_RS09505 WP_043852903.1 1973566..1973994(-) (ssbA) [Clostridium butyricum strain LV1]
MNKVVLIGRLTKDPELRFTPGSGAAVTTLTLAIDRYNPKTNQNEADFIPIVIWGKQAENTANYMSKGGQVAISGKIQTRS
YDAKDGTKRYITEVVADQFGGVQFLGNKGEVNQNDGSNNFGNMNQDIFEEDITPVDGGDMPF

Nucleotide


Download         Length: 429 bp        

>NTDB_id=766976 O4N14_RS09505 WP_043852903.1 1973566..1973994(-) (ssbA) [Clostridium butyricum strain LV1]
ATGAATAAAGTAGTTTTAATAGGAAGATTAACTAAAGATCCTGAACTTAGATTTACACCTGGAAGTGGTGCAGCAGTAAC
AACTTTAACATTAGCAATTGATAGATATAATCCAAAGACTAACCAAAATGAAGCTGATTTTATTCCTATAGTAATATGGG
GTAAACAAGCTGAAAACACTGCAAATTATATGAGTAAAGGCGGACAAGTTGCTATTAGCGGAAAAATTCAAACTAGAAGT
TATGATGCTAAAGATGGTACTAAGAGATATATTACTGAAGTAGTAGCAGATCAATTTGGTGGTGTTCAGTTTCTAGGGAA
TAAGGGTGAAGTAAATCAGAATGATGGTTCTAATAATTTTGGAAATATGAATCAAGATATATTTGAAGAGGATATAACAC
CAGTAGATGGAGGGGACATGCCTTTTTAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(1-99)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

40

100

0.493
  ssb Latilactobacillus sakei subsp. sakei 23K

46.032

88.732

0.408
  ssbB Streptococcus sobrinus strain NIDR 6715-7

38.971

95.775

0.373
  ssbB Bacillus subtilis subsp. subtilis str. 168

49.074

76.056

0.373