Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   QNH31_RS12565 Genome accession   NZ_CP126094
Coordinates   2445774..2446157 (-) Length   127 a.a.
NCBI ID   WP_041850015.1    Uniprot ID   -
Organism   Bacillus subtilis strain G2S2     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2440774..2451157
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QNH31_RS12525 (QNH31_12525) sinI 2441708..2441881 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  QNH31_RS12530 (QNH31_12530) sinR 2441915..2442250 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  QNH31_RS12535 (QNH31_12535) tasA 2442343..2443128 (-) 786 WP_015251717.1 biofilm matrix protein TasA -
  QNH31_RS12540 (QNH31_12540) sipW 2443192..2443764 (-) 573 WP_003246088.1 signal peptidase I SipW -
  QNH31_RS12545 (QNH31_12545) tapA 2443748..2444509 (-) 762 WP_015251716.1 amyloid fiber anchoring/assembly protein TapA -
  QNH31_RS12550 (QNH31_12550) yqzG 2444781..2445107 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  QNH31_RS12555 (QNH31_12555) spoIIT 2445149..2445328 (-) 180 WP_003230176.1 YqzE family protein -
  QNH31_RS12560 (QNH31_12560) comGG 2445399..2445773 (-) 375 WP_015251714.1 ComG operon protein ComGG Machinery gene
  QNH31_RS12565 (QNH31_12565) comGF 2445774..2446157 (-) 384 WP_041850015.1 ComG operon protein ComGF Machinery gene
  QNH31_RS12570 (QNH31_12570) comGE 2446183..2446530 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  QNH31_RS12575 (QNH31_12575) comGD 2446514..2446945 (-) 432 WP_004398628.1 comG operon protein ComGD Machinery gene
  QNH31_RS12580 (QNH31_12580) comGC 2446935..2447231 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  QNH31_RS12585 (QNH31_12585) comGB 2447245..2448282 (-) 1038 WP_041850016.1 comG operon protein ComGB Machinery gene
  QNH31_RS12590 (QNH31_12590) comGA 2448269..2449339 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  QNH31_RS12595 (QNH31_12595) corA 2449750..2450703 (-) 954 WP_029317911.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14250.41 Da        Isoelectric Point: 6.4838

>NTDB_id=766830 QNH31_RS12565 WP_041850015.1 2445774..2446157(-) (comGF) [Bacillus subtilis strain G2S2]
MLISGSLAAIIHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHIAAMKADIKNGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=766830 QNH31_RS12565 WP_041850015.1 2445774..2446157(-) (comGF) [Bacillus subtilis strain G2S2]
TTGCTCATATCAGGATCGTTAGCTGCGATTATCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCTATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTGCTGCCATGAAAGCTGATATTAAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACAGCTTTTCCGGTCTATTCGTATTTAGGAGGAGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

98.425

100

0.984