Detailed information
Bioinformatically predicted
Overview
| Name | ideA | Type | Regulator |
| Locus tag | H7R08_RS20045 | Genome accession | NZ_AP022095 |
| Coordinates | 4131279..4131953 (+) | Length | 224 a.a. |
| NCBI ID | WP_048608563.1 | Uniprot ID | A0A0M0HVE7 |
| Organism | Escherichia coli strain WP4-S18-ESBL-08 | ||
| Function | repress natural transformation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Genomic island | 4092371..4135816 | 4131279..4131953 | within | 0 |
| IScluster/Tn | 4116273..4131237 | 4131279..4131953 | flank | 42 |
Gene organization within MGE regions
Location: 4092371..4135816
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H7R08_RS19815 (WP4S18E08_38530) | - | 4092371..4092622 (+) | 252 | WP_024015942.1 | helix-turn-helix domain-containing protein | - |
| H7R08_RS19820 (WP4S18E08_38540) | - | 4092678..4093547 (+) | 870 | WP_024015941.1 | hypothetical protein | - |
| H7R08_RS19825 (WP4S18E08_38550) | - | 4093534..4094196 (+) | 663 | WP_024015940.1 | DUF6475 domain-containing protein | - |
| H7R08_RS19830 (WP4S18E08_38560) | - | 4094183..4094731 (+) | 549 | WP_024015939.1 | lytic transglycosylase domain-containing protein | - |
| H7R08_RS19835 (WP4S18E08_38570) | - | 4094728..4095027 (+) | 300 | WP_000210563.1 | flagellar transcriptional regulator FlhD | - |
| H7R08_RS19840 (WP4S18E08_38580) | - | 4095024..4095557 (+) | 534 | WP_000566755.1 | FlhC family transcriptional regulator | - |
| H7R08_RS19845 | eexS | 4095615..4096046 (+) | 432 | WP_024015938.1 | entry exclusion protein EexS | - |
| H7R08_RS19850 (WP4S18E08_38590) | - | 4096079..4099648 (-) | 3570 | WP_064497034.1 | conjugal transfer protein TraG N-terminal domain-containing protein | - |
| H7R08_RS19855 (WP4S18E08_38600) | - | 4099652..4101040 (-) | 1389 | WP_064497420.1 | conjugal transfer protein TraH | - |
| H7R08_RS19860 (WP4S18E08_38610) | - | 4101043..4101987 (-) | 945 | WP_053410251.1 | thioredoxin family protein | - |
| H7R08_RS19865 (WP4S18E08_38620) | - | 4102080..4102784 (-) | 705 | WP_024023022.1 | hypothetical protein | - |
| H7R08_RS19870 (WP4S18E08_38630) | - | 4102874..4103947 (-) | 1074 | WP_024023024.1 | primase-helicase zinc-binding domain-containing protein | - |
| H7R08_RS19875 (WP4S18E08_38640) | - | 4104039..4104380 (-) | 342 | WP_024023025.1 | hypothetical protein | - |
| H7R08_RS19880 (WP4S18E08_38650) | radC | 4104380..4104877 (-) | 498 | WP_000797298.1 | DNA repair protein RadC | - |
| H7R08_RS19885 (WP4S18E08_38660) | - | 4104960..4106615 (-) | 1656 | WP_053410252.1 | VWA domain-containing protein | - |
| H7R08_RS19890 (WP4S18E08_38670) | - | 4106685..4107125 (-) | 441 | WP_024023027.1 | hypothetical protein | - |
| H7R08_RS19895 (WP4S18E08_38680) | - | 4107187..4108140 (-) | 954 | WP_000027441.1 | DUF3150 domain-containing protein | - |
| H7R08_RS19900 (WP4S18E08_38690) | - | 4108239..4109006 (-) | 768 | WP_053410253.1 | hypothetical protein | - |
| H7R08_RS19905 (WP4S18E08_38700) | - | 4109006..4109965 (-) | 960 | WP_024015927.1 | AAA family ATPase | - |
| H7R08_RS19910 (WP4S18E08_38710) | - | 4110175..4111191 (-) | 1017 | WP_024015926.1 | lambda-exonuclease family protein | - |
| H7R08_RS19915 (WP4S18E08_38720) | - | 4111252..4111395 (-) | 144 | WP_015066581.1 | hypothetical protein | - |
| H7R08_RS19920 (WP4S18E08_38730) | bet | 4111478..4112296 (-) | 819 | WP_000414662.1 | phage recombination protein Bet | - |
| H7R08_RS19925 (WP4S18E08_38740) | ssb | 4112376..4112795 (-) | 420 | WP_012368368.1 | single-stranded DNA-binding protein | - |
| H7R08_RS19930 (WP4S18E08_38750) | - | 4112811..4113137 (-) | 327 | WP_048608521.1 | hypothetical protein | - |
| H7R08_RS19935 (WP4S18E08_38760) | - | 4113504..4114106 (+) | 603 | WP_048608523.1 | hypothetical protein | - |
| H7R08_RS19940 (WP4S18E08_38770) | cadR | 4114336..4114743 (-) | 408 | WP_004364961.1 | Cd(II)/Pb(II)-responsive transcriptional regulator | - |
| H7R08_RS19945 (WP4S18E08_38780) | - | 4114839..4115735 (+) | 897 | WP_071192896.1 | cation transporter | - |
| H7R08_RS19950 (WP4S18E08_38790) | lspA | 4115739..4116251 (+) | 513 | WP_004863699.1 | signal peptidase II | - |
| H7R08_RS19955 (WP4S18E08_38800) | - | 4116273..4117562 (+) | 1290 | WP_004574636.1 | ISL3-like element ISPpu12 family transposase | - |
| H7R08_RS19960 (WP4S18E08_38810) | - | 4117695..4118533 (-) | 839 | Protein_3962 | AadA family aminoglycoside 3''-O-nucleotidyltransferase | - |
| H7R08_RS19965 (WP4S18E08_38820) | ere(A) | 4118618..4119838 (-) | 1221 | WP_032084014.1 | EreA family erythromycin esterase | - |
| H7R08_RS19970 (WP4S18E08_38830) | dfrA32 | 4120031..4120504 (-) | 474 | WP_032084013.1 | trimethoprim-resistant dihydrofolate reductase DfrA32 | - |
| H7R08_RS19975 (WP4S18E08_38840) | intI1 | 4120662..4121459 (+) | 798 | Protein_3965 | class 1 integron integrase IntI1 | - |
| H7R08_RS19980 (WP4S18E08_38850) | - | 4121512..4122216 (-) | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| H7R08_RS19985 (WP4S18E08_38860) | - | 4122346..4123161 (+) | 816 | WP_000018329.1 | aminoglycoside O-phosphotransferase APH(3')-Ia | - |
| H7R08_RS19990 (WP4S18E08_38870) | - | 4123351..4124055 (-) | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| H7R08_RS25555 (WP4S18E08_38880) | - | 4124587..4124901 (-) | 315 | WP_061342203.1 | helix-turn-helix transcriptional regulator | - |
| H7R08_RS20000 (WP4S18E08_38890) | tetR(C) | 4124888..4125547 (-) | 660 | WP_001038045.1 | tetracycline resistance transcriptional repressor TetR(C) | - |
| H7R08_RS20005 (WP4S18E08_38900) | tet(C) | 4125640..4126830 (+) | 1191 | WP_053409934.1 | tetracycline efflux MFS transporter Tet(C) | - |
| H7R08_RS20010 | - | 4126734..4127072 (+) | 339 | WP_002310911.1 | hypothetical protein | - |
| H7R08_RS25345 | - | 4127077..4127268 (+) | 192 | WP_009873362.1 | hypothetical protein | - |
| H7R08_RS20020 (WP4S18E08_38920) | - | 4127280..4127549 (+) | 270 | Protein_3974 | hypothetical protein | - |
| H7R08_RS20025 (WP4S18E08_38930) | cadR | 4128013..4128420 (-) | 408 | WP_053409935.1 | Cd(II)/Pb(II)-responsive transcriptional regulator | - |
| H7R08_RS20030 (WP4S18E08_38940) | - | 4128516..4129412 (+) | 897 | WP_053409936.1 | cation transporter | - |
| H7R08_RS20035 (WP4S18E08_38950) | lspA | 4129416..4129928 (+) | 513 | WP_003821921.1 | signal peptidase II | - |
| H7R08_RS20040 | - | 4129950..4131237 (+) | 1288 | Protein_3978 | ISL3 family transposase | - |
| H7R08_RS20045 | ideA | 4131279..4131953 (+) | 675 | WP_048608563.1 | endonuclease | Regulator |
| H7R08_RS20050 (WP4S18E08_38990) | - | 4132362..4134401 (-) | 2040 | WP_004249372.1 | DUF87 domain-containing protein | - |
| H7R08_RS20055 (WP4S18E08_39000) | - | 4134398..4135816 (-) | 1419 | WP_004249371.1 | SIR2 family protein | - |
Sequence
Protein
Download Length: 224 a.a. Molecular weight: 26077.09 Da Isoelectric Point: 7.2404
>NTDB_id=76622 H7R08_RS20045 WP_048608563.1 4131279..4131953(+) (ideA) [Escherichia coli strain WP4-S18-ESBL-08]
MKSVYPFFIALFAIPAIAEHPTSFSQAKRFAREIYQDNQSTFYCGCSYSNDGAIDAASCGYEPRKQPKRGERLEWEHVVS
AWEIGHQRQCWQNGGRRNCEKNDPEFSKMVSDLHNLVPSVGELNGDRSNFRFGMIPNEPRSYGQCDFEVDFKDRRAEPPA
NRQGDIARIYFYMRDQYGLRLSRQQTQLFEAWSRMDPVDEWEKVRDFKIKTIQGNSNCHVSNSC
MKSVYPFFIALFAIPAIAEHPTSFSQAKRFAREIYQDNQSTFYCGCSYSNDGAIDAASCGYEPRKQPKRGERLEWEHVVS
AWEIGHQRQCWQNGGRRNCEKNDPEFSKMVSDLHNLVPSVGELNGDRSNFRFGMIPNEPRSYGQCDFEVDFKDRRAEPPA
NRQGDIARIYFYMRDQYGLRLSRQQTQLFEAWSRMDPVDEWEKVRDFKIKTIQGNSNCHVSNSC
Nucleotide
Download Length: 675 bp
>NTDB_id=76622 H7R08_RS20045 WP_048608563.1 4131279..4131953(+) (ideA) [Escherichia coli strain WP4-S18-ESBL-08]
ATTAAATCCGTATACCCTTTCTTTATAGCGTTATTCGCTATACCTGCAATTGCAGAACACCCCACATCGTTCAGTCAGGC
AAAACGATTTGCCCGAGAAATTTACCAAGACAACCAGAGTACGTTTTACTGTGGATGTAGCTATAGCAATGATGGTGCGA
TTGATGCTGCATCTTGCGGATATGAACCAAGAAAGCAACCGAAACGAGGTGAACGCTTAGAGTGGGAACATGTAGTCTCA
GCTTGGGAAATTGGCCATCAACGCCAATGCTGGCAAAATGGTGGTCGTCGGAACTGCGAAAAGAATGATCCTGAGTTTTC
TAAAATGGTTTCGGATCTCCATAACCTCGTACCATCTGTAGGAGAGCTCAATGGGGATAGGTCAAATTTTCGATTTGGCA
TGATTCCGAATGAACCAAGATCCTATGGTCAATGTGATTTCGAAGTTGATTTCAAAGACCGTCGAGCAGAACCACCAGCT
AACCGTCAGGGTGATATTGCTAGAATTTATTTCTACATGCGAGATCAATACGGCCTAAGACTCAGTAGGCAACAAACTCA
GCTATTTGAAGCTTGGTCAAGAATGGACCCTGTTGACGAATGGGAAAAAGTGCGTGATTTTAAGATTAAAACTATTCAAG
GTAACTCTAACTGCCATGTGTCAAATAGCTGTTAA
ATTAAATCCGTATACCCTTTCTTTATAGCGTTATTCGCTATACCTGCAATTGCAGAACACCCCACATCGTTCAGTCAGGC
AAAACGATTTGCCCGAGAAATTTACCAAGACAACCAGAGTACGTTTTACTGTGGATGTAGCTATAGCAATGATGGTGCGA
TTGATGCTGCATCTTGCGGATATGAACCAAGAAAGCAACCGAAACGAGGTGAACGCTTAGAGTGGGAACATGTAGTCTCA
GCTTGGGAAATTGGCCATCAACGCCAATGCTGGCAAAATGGTGGTCGTCGGAACTGCGAAAAGAATGATCCTGAGTTTTC
TAAAATGGTTTCGGATCTCCATAACCTCGTACCATCTGTAGGAGAGCTCAATGGGGATAGGTCAAATTTTCGATTTGGCA
TGATTCCGAATGAACCAAGATCCTATGGTCAATGTGATTTCGAAGTTGATTTCAAAGACCGTCGAGCAGAACCACCAGCT
AACCGTCAGGGTGATATTGCTAGAATTTATTTCTACATGCGAGATCAATACGGCCTAAGACTCAGTAGGCAACAAACTCA
GCTATTTGAAGCTTGGTCAAGAATGGACCCTGTTGACGAATGGGAAAAAGTGCGTGATTTTAAGATTAAAACTATTCAAG
GTAACTCTAACTGCCATGTGTCAAATAGCTGTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ideA | Vibrio cholerae O1 str. 2010EL-1786 |
92.76 |
98.661 |
0.915 |
| dns | Vibrio parahaemolyticus RIMD 2210633 |
52.381 |
100 |
0.54 |
| dns | Aliivibrio fischeri ES114 |
52.423 |
100 |
0.531 |
| dns | Vibrio cholerae strain A1552 |
50.661 |
100 |
0.513 |
| dns | Campylobacter jejuni RM1221 |
37.674 |
95.982 |
0.362 |