Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   O1449_RS12435 Genome accession   NZ_CP114264
Coordinates   2618463..2618816 (+) Length   117 a.a.
NCBI ID   WP_269228766.1    Uniprot ID   A0A9E9L3F1
Organism   Acinetobacter sp. TR3     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2586748..2621167 2618463..2618816 within 0


Gene organization within MGE regions


Location: 2586748..2621167
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  O1449_RS12215 (O1449_12230) - 2586748..2587821 (-) 1074 WP_269228721.1 phage portal protein -
  O1449_RS12220 (O1449_12235) - 2587818..2589581 (-) 1764 WP_269238470.1 terminase family protein -
  O1449_RS12225 (O1449_12240) - 2589779..2590693 (+) 915 WP_269228723.1 GPO family capsid scaffolding protein -
  O1449_RS12230 (O1449_12245) - 2590749..2591786 (+) 1038 WP_269228724.1 phage major capsid protein, P2 family -
  O1449_RS12235 (O1449_12250) gpM 2591786..2592697 (+) 912 WP_269228725.1 phage terminase small subunit -
  O1449_RS12240 (O1449_12255) - 2592705..2593115 (+) 411 WP_269228726.1 head completion/stabilization protein -
  O1449_RS12245 (O1449_12260) - 2593112..2593318 (+) 207 WP_269228727.1 tail protein X -
  O1449_RS12250 (O1449_12265) - 2593333..2593668 (+) 336 WP_269228728.1 phage holin family protein -
  O1449_RS12255 (O1449_12270) - 2593665..2594210 (+) 546 WP_269228729.1 N-acetylmuramidase -
  O1449_RS12260 (O1449_12275) - 2594222..2594608 (+) 387 WP_269228730.1 phage tail protein -
  O1449_RS12265 (O1449_12280) - 2594605..2595042 (+) 438 WP_269228731.1 phage virion morphogenesis protein -
  O1449_RS12270 (O1449_12285) - 2595199..2596035 (+) 837 WP_269228732.1 DNA adenine methylase -
  O1449_RS12275 (O1449_12290) - 2596128..2596643 (+) 516 WP_269228733.1 phage baseplate assembly protein V -
  O1449_RS12280 (O1449_12295) - 2596640..2597005 (+) 366 WP_269228734.1 GPW/gp25 family protein -
  O1449_RS12285 (O1449_12300) - 2597002..2597901 (+) 900 WP_269228735.1 baseplate J/gp47 family protein -
  O1449_RS12290 (O1449_12305) - 2597894..2598418 (+) 525 WP_269228736.1 phage tail protein I -
  O1449_RS12295 (O1449_12310) - 2598437..2599408 (+) 972 WP_269228737.1 hypothetical protein -
  O1449_RS12300 (O1449_12315) - 2599409..2600941 (+) 1533 WP_269228738.1 phage tail protein -
  O1449_RS12305 (O1449_12320) - 2600971..2601600 (+) 630 WP_269228739.1 hypothetical protein -
  O1449_RS12310 (O1449_12325) - 2601609..2602649 (+) 1041 WP_269228740.1 LamG-like jellyroll fold domain-containing protein -
  O1449_RS12315 (O1449_12330) - 2602677..2603321 (+) 645 WP_269228741.1 phage tail sheath C-terminal domain-containing protein -
  O1449_RS12320 (O1449_12335) - 2603322..2603828 (+) 507 WP_269228742.1 phage major tail tube protein -
  O1449_RS12325 (O1449_12340) - 2603873..2604214 (+) 342 WP_269228743.1 phage tail assembly protein -
  O1449_RS12330 (O1449_12345) - 2604214..2604333 (+) 120 WP_269239714.1 GpE family phage tail protein -
  O1449_RS12335 (O1449_12350) - 2604342..2607017 (+) 2676 WP_269228745.1 phage tail tape measure protein -
  O1449_RS12340 (O1449_12355) - 2607028..2607414 (+) 387 WP_269228746.1 phage tail protein -
  O1449_RS12345 (O1449_12360) - 2607411..2608421 (+) 1011 WP_269228747.1 contractile injection system protein, VgrG/Pvc8 family -
  O1449_RS12350 (O1449_12365) - 2608418..2608585 (-) 168 WP_269228748.1 hypothetical protein -
  O1449_RS12355 (O1449_12370) - 2608644..2608823 (-) 180 WP_269228749.1 hypothetical protein -
  O1449_RS12360 (O1449_12375) - 2608973..2609266 (-) 294 WP_269228750.1 hypothetical protein -
  O1449_RS12365 (O1449_12380) - 2609417..2609716 (-) 300 WP_269228751.1 hypothetical protein -
  O1449_RS12370 (O1449_12385) - 2610150..2610344 (+) 195 WP_269228752.1 hypothetical protein -
  O1449_RS12375 (O1449_12390) - 2610551..2611102 (-) 552 WP_269228753.1 hypothetical protein -
  O1449_RS12380 (O1449_12395) - 2611448..2611633 (+) 186 WP_269228754.1 hypothetical protein -
  O1449_RS12385 (O1449_12400) - 2611644..2612339 (+) 696 WP_269228755.1 hypothetical protein -
  O1449_RS12390 (O1449_12405) - 2612336..2612668 (+) 333 WP_269228756.1 hypothetical protein -
  O1449_RS12395 (O1449_12410) - 2612823..2613176 (-) 354 WP_269228758.1 helix-turn-helix transcriptional regulator -
  O1449_RS12400 (O1449_12415) - 2613313..2613504 (+) 192 WP_269228759.1 hypothetical protein -
  O1449_RS12405 (O1449_12420) - 2613776..2614183 (+) 408 WP_269228760.1 ogr/Delta-like zinc finger family protein -
  O1449_RS12410 (O1449_12425) - 2614180..2616906 (+) 2727 WP_269228761.1 toprim domain-containing protein -
  O1449_RS12415 (O1449_12430) - 2616915..2617130 (+) 216 WP_269228762.1 hypothetical protein -
  O1449_RS12420 (O1449_12435) - 2617196..2617627 (+) 432 WP_269228763.1 DUF2528 family protein -
  O1449_RS12425 (O1449_12440) - 2617631..2618071 (+) 441 WP_269228764.1 hypothetical protein -
  O1449_RS12430 (O1449_12445) - 2618068..2618466 (+) 399 WP_269228765.1 hypothetical protein -
  O1449_RS12435 (O1449_12450) ssb 2618463..2618816 (+) 354 WP_269228766.1 single-stranded DNA-binding protein Machinery gene
  O1449_RS12440 (O1449_12455) - 2619032..2619742 (+) 711 WP_269228767.1 3'-5' exonuclease -
  O1449_RS12445 (O1449_12460) - 2619739..2620029 (+) 291 WP_269228768.1 hypothetical protein -
  O1449_RS12450 (O1449_12465) - 2620058..2621116 (-) 1059 WP_269228769.1 site-specific integrase -

Sequence


Protein


Download         Length: 117 a.a.        Molecular weight: 13177.84 Da        Isoelectric Point: 9.8874

>NTDB_id=765301 O1449_RS12435 WP_269228766.1 2618463..2618816(+) (ssb) [Acinetobacter sp. TR3]
MRGVNKVILVGSLGADPQKKGFPNGGSYAQFSIATSESWQDKQTGEWKENTEWHRIVANGRLGDIAAQYLKKGSKVYVEG
SLRTRLWKDQNNVERYITEVKLNSMQMLDSAPQANPY

Nucleotide


Download         Length: 354 bp        

>NTDB_id=765301 O1449_RS12435 WP_269228766.1 2618463..2618816(+) (ssb) [Acinetobacter sp. TR3]
ATGAGAGGCGTAAATAAAGTTATTTTAGTCGGTTCTCTTGGTGCAGATCCGCAGAAAAAAGGTTTTCCAAATGGCGGATC
ATATGCCCAATTTTCAATAGCAACATCTGAAAGTTGGCAAGATAAGCAAACTGGGGAATGGAAAGAAAATACAGAATGGC
ATCGCATTGTTGCCAACGGGAGATTGGGCGATATCGCTGCACAATATCTAAAAAAAGGTTCAAAAGTTTATGTCGAGGGT
TCTCTCCGAACACGATTGTGGAAAGACCAGAATAATGTTGAACGCTATATCACTGAAGTGAAGCTCAACAGCATGCAGAT
GCTCGACTCAGCCCCACAAGCAAACCCATATTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Glaesserella parasuis strain SC1401

60.909

94.017

0.573

  ssb Vibrio cholerae strain A1552

55.856

94.872

0.53

  ssb Neisseria gonorrhoeae MS11

45.714

89.744

0.41

  ssb Neisseria meningitidis MC58

45.714

89.744

0.41