Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | OR605_RS04025 | Genome accession | NZ_CP113522 |
| Coordinates | 800818..801267 (-) | Length | 149 a.a. |
| NCBI ID | WP_266199913.1 | Uniprot ID | - |
| Organism | Pasteurella multocida strain PF13 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 795638..839162 | 800818..801267 | within | 0 |
Gene organization within MGE regions
Location: 795638..839162
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OR605_RS03980 (OR605_03980) | - | 795638..796690 (-) | 1053 | WP_250010829.1 | tyrosine-type recombinase/integrase | - |
| OR605_RS03985 (OR605_03985) | - | 796600..796932 (-) | 333 | WP_015691045.1 | helix-turn-helix domain-containing protein | - |
| OR605_RS03990 (OR605_03990) | - | 797060..797515 (-) | 456 | WP_267174532.1 | pyruvate kinase | - |
| OR605_RS03995 (OR605_03995) | - | 797561..797866 (-) | 306 | WP_108575008.1 | hypothetical protein | - |
| OR605_RS04000 (OR605_04000) | - | 797878..798408 (-) | 531 | WP_225529740.1 | DUF551 domain-containing protein | - |
| OR605_RS04005 (OR605_04005) | rdgC | 798552..799454 (-) | 903 | WP_267174533.1 | recombination-associated protein RdgC | - |
| OR605_RS04010 (OR605_04010) | - | 799457..799840 (-) | 384 | WP_267174534.1 | hypothetical protein | - |
| OR605_RS04015 (OR605_04015) | - | 799919..800230 (-) | 312 | WP_014390701.1 | DUF6378 domain-containing protein | - |
| OR605_RS04020 (OR605_04020) | - | 800230..800751 (-) | 522 | WP_014390702.1 | MazG-like family protein | - |
| OR605_RS04025 (OR605_04025) | ssb | 800818..801267 (-) | 450 | WP_266199913.1 | single-stranded DNA-binding protein | Machinery gene |
| OR605_RS04030 (OR605_04030) | - | 801267..801926 (-) | 660 | WP_041423209.1 | translocation protein TolB precursor | - |
| OR605_RS04035 (OR605_04035) | - | 801913..802865 (-) | 953 | Protein_782 | recombinase RecT | - |
| OR605_RS04040 (OR605_04040) | - | 802867..803154 (-) | 288 | WP_014391452.1 | hypothetical protein | - |
| OR605_RS04045 (OR605_04045) | - | 803167..803403 (-) | 237 | WP_075271355.1 | hypothetical protein | - |
| OR605_RS04050 (OR605_04050) | - | 803375..803674 (-) | 300 | WP_078802174.1 | hypothetical protein | - |
| OR605_RS04055 (OR605_04055) | - | 803822..804019 (+) | 198 | WP_268169362.1 | hypothetical protein | - |
| OR605_RS04060 (OR605_04060) | - | 804184..804921 (-) | 738 | WP_326498476.1 | KilA-N domain-containing protein | - |
| OR605_RS04065 (OR605_04065) | - | 805060..805437 (-) | 378 | Protein_788 | Bro-N domain-containing protein | - |
| OR605_RS04070 (OR605_04070) | - | 805778..805903 (+) | 126 | WP_014391103.1 | hypothetical protein | - |
| OR605_RS04075 (OR605_04075) | - | 805904..806437 (-) | 534 | WP_014391102.1 | hypothetical protein | - |
| OR605_RS04080 (OR605_04080) | - | 806525..806788 (-) | 264 | WP_071522857.1 | hypothetical protein | - |
| OR605_RS04085 (OR605_04085) | - | 807000..807194 (+) | 195 | WP_014391459.1 | hypothetical protein | - |
| OR605_RS04090 (OR605_04090) | - | 807175..807345 (-) | 171 | WP_014391460.1 | hypothetical protein | - |
| OR605_RS04095 (OR605_04095) | - | 807358..807588 (-) | 231 | WP_075271373.1 | hypothetical protein | - |
| OR605_RS04100 (OR605_04100) | - | 807830..808039 (-) | 210 | WP_005756656.1 | hypothetical protein | - |
| OR605_RS04105 (OR605_04105) | - | 808052..808219 (+) | 168 | WP_005756653.1 | YegP family protein | - |
| OR605_RS04110 (OR605_04110) | - | 808524..808838 (+) | 315 | WP_078819687.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| OR605_RS04115 (OR605_04115) | - | 808835..809125 (+) | 291 | WP_265176302.1 | addiction module antidote protein | - |
| OR605_RS04120 (OR605_04120) | - | 809152..810072 (-) | 921 | WP_265164248.1 | hypothetical protein | - |
| OR605_RS04125 (OR605_04125) | - | 810163..810819 (-) | 657 | WP_016570077.1 | LexA family transcriptional regulator | - |
| OR605_RS04130 (OR605_04130) | - | 810950..811156 (+) | 207 | WP_071523618.1 | helix-turn-helix transcriptional regulator | - |
| OR605_RS04135 (OR605_04135) | - | 811205..811666 (+) | 462 | WP_267174535.1 | phage regulatory CII family protein | - |
| OR605_RS04140 (OR605_04140) | - | 811718..812400 (+) | 683 | Protein_803 | phage antirepressor KilAC domain-containing protein | - |
| OR605_RS04145 (OR605_04145) | - | 812397..812528 (+) | 132 | WP_268169363.1 | hypothetical protein | - |
| OR605_RS04150 (OR605_04150) | - | 812613..813428 (+) | 816 | WP_266199956.1 | helix-turn-helix domain-containing protein | - |
| OR605_RS04155 (OR605_04155) | - | 813428..814180 (+) | 753 | WP_266206421.1 | replication protein P | - |
| OR605_RS04160 (OR605_04160) | - | 814120..814656 (+) | 537 | WP_178384709.1 | phage N-6-adenine-methyltransferase | - |
| OR605_RS04165 (OR605_04165) | - | 814646..815104 (+) | 459 | WP_014391471.1 | recombination protein NinB | - |
| OR605_RS12105 | - | 815178..815393 (+) | 216 | Protein_809 | hypothetical protein | - |
| OR605_RS04170 (OR605_04170) | - | 815386..815989 (+) | 604 | Protein_810 | recombination protein NinG | - |
| OR605_RS04175 (OR605_04175) | - | 815990..816451 (+) | 462 | WP_014667792.1 | antiterminator Q family protein | - |
| OR605_RS04180 (OR605_04180) | - | 816577..817140 (-) | 564 | WP_014667793.1 | hypothetical protein | - |
| OR605_RS04185 (OR605_04185) | - | 817258..817515 (+) | 258 | WP_081376958.1 | HP1 family phage holin | - |
| OR605_RS04190 (OR605_04190) | - | 817512..818042 (+) | 531 | WP_069915984.1 | lysozyme | - |
| OR605_RS04195 (OR605_04195) | - | 818015..818338 (+) | 324 | WP_078801840.1 | DUF2570 family protein | - |
| OR605_RS04200 (OR605_04200) | - | 818548..818916 (-) | 369 | WP_014391478.1 | helix-turn-helix domain-containing protein | - |
| OR605_RS04205 (OR605_04205) | - | 818952..819212 (-) | 261 | WP_005720780.1 | type II toxin-antitoxin system RelE family toxin | - |
| OR605_RS04210 (OR605_04210) | - | 819502..819975 (+) | 474 | WP_014391479.1 | DUF1441 family protein | - |
| OR605_RS04215 (OR605_04215) | - | 819979..822087 (+) | 2109 | WP_014391480.1 | phage terminase large subunit family protein | - |
| OR605_RS04220 (OR605_04220) | - | 822084..822305 (+) | 222 | WP_014391481.1 | hypothetical protein | - |
| OR605_RS04225 (OR605_04225) | - | 822302..823840 (+) | 1539 | WP_267174539.1 | phage portal protein | - |
| OR605_RS04230 (OR605_04230) | - | 823776..825785 (+) | 2010 | WP_267174540.1 | ClpP-like prohead protease/major capsid protein fusion protein | - |
| OR605_RS04235 (OR605_04235) | - | 825858..826184 (+) | 327 | WP_267174541.1 | DUF2190 family protein | - |
| OR605_RS04240 (OR605_04240) | - | 826177..826470 (+) | 294 | WP_014391484.1 | hypothetical protein | - |
| OR605_RS04245 (OR605_04245) | - | 826470..827021 (+) | 552 | WP_014391485.1 | phage tail protein | - |
| OR605_RS04250 (OR605_04250) | gpU | 827018..827425 (+) | 408 | WP_014391486.1 | phage tail terminator protein | - |
| OR605_RS04255 (OR605_04255) | - | 827580..827927 (+) | 348 | WP_268169364.1 | phage tail tube protein | - |
| OR605_RS04260 (OR605_04260) | - | 827933..828322 (+) | 390 | WP_016533230.1 | phage minor tail protein G | - |
| OR605_RS04265 (OR605_04265) | - | 828343..828645 (+) | 303 | WP_225529681.1 | phage tail assembly protein T | - |
| OR605_RS04270 (OR605_04270) | - | 828632..830155 (+) | 1524 | WP_268169365.1 | phage tail length tape measure family protein | - |
| OR605_RS04275 (OR605_04275) | - | 830077..830823 (+) | 747 | WP_268169366.1 | hypothetical protein | - |
| OR605_RS04280 (OR605_04280) | - | 830999..831349 (+) | 351 | WP_005719622.1 | phage tail protein | - |
| OR605_RS04285 (OR605_04285) | - | 831421..831987 (+) | 567 | WP_078819667.1 | hypothetical protein | - |
| OR605_RS04290 (OR605_04290) | - | 832141..832845 (+) | 705 | WP_080166595.1 | phage minor tail protein L | - |
| OR605_RS04295 (OR605_04295) | - | 832850..833592 (+) | 743 | Protein_835 | C40 family peptidase | - |
| OR605_RS04300 (OR605_04300) | - | 833535..834155 (+) | 621 | WP_014667799.1 | tail assembly protein | - |
| OR605_RS04305 (OR605_04305) | - | 834159..839162 (+) | 5004 | WP_268169367.1 | phage tail protein | - |
Sequence
Protein
Download Length: 149 a.a. Molecular weight: 17024.90 Da Isoelectric Point: 6.9835
>NTDB_id=762711 OR605_RS04025 WP_266199913.1 800818..801267(-) (ssb) [Pasteurella multocida strain PF13]
MAGVNRVIILGNLGSDPEIRTMPNGDPVAKISVATSESWIDKNTNERKTQTEWHSIVFYRRQAEICGQYLKKGSKVYVEG
KLRTRKWQDQNGQDRYTTEIQGDVLQMLDSRQDSQQQQAQAPQNNAYANAKSGKPVQKFDNFEEDDIPF
MAGVNRVIILGNLGSDPEIRTMPNGDPVAKISVATSESWIDKNTNERKTQTEWHSIVFYRRQAEICGQYLKKGSKVYVEG
KLRTRKWQDQNGQDRYTTEIQGDVLQMLDSRQDSQQQQAQAPQNNAYANAKSGKPVQKFDNFEEDDIPF
Nucleotide
Download Length: 450 bp
>NTDB_id=762711 OR605_RS04025 WP_266199913.1 800818..801267(-) (ssb) [Pasteurella multocida strain PF13]
ATGGCTGGGGTTAATCGTGTAATTATTTTAGGAAATTTAGGAAGCGATCCTGAAATCCGCACAATGCCAAATGGCGACCC
TGTGGCAAAAATCAGTGTGGCCACAAGTGAAAGCTGGATTGATAAAAACACAAACGAACGAAAAACACAAACTGAATGGC
ATTCTATCGTGTTCTATCGTCGCCAAGCAGAAATTTGCGGGCAGTATTTGAAGAAAGGCTCGAAAGTTTATGTGGAAGGT
AAGCTCAGAACACGCAAATGGCAAGATCAAAATGGTCAAGACCGCTACACCACAGAGATTCAAGGCGACGTATTACAAAT
GCTAGACAGTCGCCAAGATTCACAGCAACAGCAAGCACAGGCACCACAAAATAATGCTTATGCGAATGCGAAAAGTGGAA
AACCAGTGCAGAAGTTTGATAATTTTGAAGAAGACGATATACCGTTTTGA
ATGGCTGGGGTTAATCGTGTAATTATTTTAGGAAATTTAGGAAGCGATCCTGAAATCCGCACAATGCCAAATGGCGACCC
TGTGGCAAAAATCAGTGTGGCCACAAGTGAAAGCTGGATTGATAAAAACACAAACGAACGAAAAACACAAACTGAATGGC
ATTCTATCGTGTTCTATCGTCGCCAAGCAGAAATTTGCGGGCAGTATTTGAAGAAAGGCTCGAAAGTTTATGTGGAAGGT
AAGCTCAGAACACGCAAATGGCAAGATCAAAATGGTCAAGACCGCTACACCACAGAGATTCAAGGCGACGTATTACAAAT
GCTAGACAGTCGCCAAGATTCACAGCAACAGCAAGCACAGGCACCACAAAATAATGCTTATGCGAATGCGAAAAGTGGAA
AACCAGTGCAGAAGTTTGATAATTTTGAAGAAGACGATATACCGTTTTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Glaesserella parasuis strain SC1401 |
61.878 |
100 |
0.752 |
| ssb | Vibrio cholerae strain A1552 |
52.518 |
93.289 |
0.49 |
| ssb | Neisseria meningitidis MC58 |
39.548 |
100 |
0.47 |
| ssb | Neisseria gonorrhoeae MS11 |
43.796 |
91.946 |
0.403 |