Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   OVA33_RS12670 Genome accession   NZ_CP113515
Coordinates   2444377..2444754 (+) Length   125 a.a.
NCBI ID   WP_017418138.1    Uniprot ID   -
Organism   Bacillus sp. KICET-1     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2439377..2449754
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  OVA33_RS12635 (OVA33_12640) - 2439692..2440642 (+) 951 WP_014418379.1 magnesium transporter CorA family protein -
  OVA33_RS12640 (OVA33_12645) comGA 2440835..2441905 (+) 1071 WP_012117985.1 competence type IV pilus ATPase ComGA Machinery gene
  OVA33_RS12645 (OVA33_12650) comGB 2441892..2442929 (+) 1038 WP_053284924.1 competence type IV pilus assembly protein ComGB Machinery gene
  OVA33_RS12650 (OVA33_12655) comGC 2442934..2443242 (+) 309 WP_014418376.1 competence type IV pilus major pilin ComGC Machinery gene
  OVA33_RS12655 (OVA33_12660) comGD 2443232..2443669 (+) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  OVA33_RS12660 (OVA33_12665) comGE 2443653..2443967 (+) 315 WP_017418140.1 competence type IV pilus minor pilin ComGE Machinery gene
  OVA33_RS12665 (OVA33_12670) comGF 2443981..2444376 (+) 396 WP_025649850.1 competence type IV pilus minor pilin ComGF -
  OVA33_RS12670 (OVA33_12675) comGG 2444377..2444754 (+) 378 WP_017418138.1 competence type IV pilus minor pilin ComGG Machinery gene
  OVA33_RS12675 (OVA33_12680) - 2444811..2444990 (+) 180 WP_003153093.1 YqzE family protein -
  OVA33_RS12680 (OVA33_12685) - 2445031..2445360 (-) 330 WP_012117979.1 DUF3889 domain-containing protein -
  OVA33_RS12685 (OVA33_12690) tapA 2445619..2446290 (+) 672 WP_025649852.1 amyloid fiber anchoring/assembly protein TapA -
  OVA33_RS12690 (OVA33_12695) - 2446262..2446846 (+) 585 WP_014418370.1 signal peptidase I -
  OVA33_RS12695 (OVA33_12700) - 2446911..2447696 (+) 786 WP_017418136.1 TasA family protein -
  OVA33_RS12700 (OVA33_12705) sinR 2447744..2448079 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  OVA33_RS12705 (OVA33_12710) sinI 2448113..2448286 (-) 174 WP_014418369.1 anti-repressor SinI family protein Regulator
  OVA33_RS12710 (OVA33_12715) - 2448463..2449257 (-) 795 WP_014418368.1 YqhG family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14125.01 Da        Isoelectric Point: 9.7165

>NTDB_id=762540 OVA33_RS12670 WP_017418138.1 2444377..2444754(+) (comGG) [Bacillus sp. KICET-1]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKGQTGTQRFPYGTVS
FHITGSDRRETVQVTIQAETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=762540 OVA33_RS12670 WP_017418138.1 2444377..2444754(+) (comGG) [Bacillus sp. KICET-1]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCCGGGGAGTACTGGATCGGAGAGAACCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGGCCAAACTGGTACACAGCGTTTTCCGTACGGCACCGTTTCT
TTTCACATCACCGGGAGTGATCGAAGGGAAACGGTTCAGGTTACAATTCAGGCGGAAACCACGACAGGCACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

51.613

99.2

0.512