Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   OVA33_RS12705 Genome accession   NZ_CP113515
Coordinates   2448113..2448286 (-) Length   57 a.a.
NCBI ID   WP_014418369.1    Uniprot ID   I2C7P2
Organism   Bacillus sp. KICET-1     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2443113..2453286
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  OVA33_RS12655 (OVA33_12660) comGD 2443232..2443669 (+) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  OVA33_RS12660 (OVA33_12665) comGE 2443653..2443967 (+) 315 WP_017418140.1 competence type IV pilus minor pilin ComGE Machinery gene
  OVA33_RS12665 (OVA33_12670) comGF 2443981..2444376 (+) 396 WP_025649850.1 competence type IV pilus minor pilin ComGF -
  OVA33_RS12670 (OVA33_12675) comGG 2444377..2444754 (+) 378 WP_017418138.1 competence type IV pilus minor pilin ComGG Machinery gene
  OVA33_RS12675 (OVA33_12680) - 2444811..2444990 (+) 180 WP_003153093.1 YqzE family protein -
  OVA33_RS12680 (OVA33_12685) - 2445031..2445360 (-) 330 WP_012117979.1 DUF3889 domain-containing protein -
  OVA33_RS12685 (OVA33_12690) tapA 2445619..2446290 (+) 672 WP_025649852.1 amyloid fiber anchoring/assembly protein TapA -
  OVA33_RS12690 (OVA33_12695) - 2446262..2446846 (+) 585 WP_014418370.1 signal peptidase I -
  OVA33_RS12695 (OVA33_12700) - 2446911..2447696 (+) 786 WP_017418136.1 TasA family protein -
  OVA33_RS12700 (OVA33_12705) sinR 2447744..2448079 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  OVA33_RS12705 (OVA33_12710) sinI 2448113..2448286 (-) 174 WP_014418369.1 anti-repressor SinI family protein Regulator
  OVA33_RS12710 (OVA33_12715) - 2448463..2449257 (-) 795 WP_014418368.1 YqhG family protein -
  OVA33_RS12715 (OVA33_12720) - 2449279..2450949 (-) 1671 WP_021494309.1 SNF2-related protein -
  OVA33_RS12720 (OVA33_12725) gcvT 2451373..2452473 (+) 1101 WP_017418134.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6642.60 Da        Isoelectric Point: 9.8168

>NTDB_id=762542 OVA33_RS12705 WP_014418369.1 2448113..2448286(-) (sinI) [Bacillus sp. KICET-1]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=762542 OVA33_RS12705 WP_014418369.1 2448113..2448286(-) (sinI) [Bacillus sp. KICET-1]
ATGAAAAATGCAAAAACAGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-37)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719