Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | OVA33_RS12705 | Genome accession | NZ_CP113515 |
| Coordinates | 2448113..2448286 (-) | Length | 57 a.a. |
| NCBI ID | WP_014418369.1 | Uniprot ID | I2C7P2 |
| Organism | Bacillus sp. KICET-1 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2443113..2453286
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OVA33_RS12655 (OVA33_12660) | comGD | 2443232..2443669 (+) | 438 | WP_007612572.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| OVA33_RS12660 (OVA33_12665) | comGE | 2443653..2443967 (+) | 315 | WP_017418140.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| OVA33_RS12665 (OVA33_12670) | comGF | 2443981..2444376 (+) | 396 | WP_025649850.1 | competence type IV pilus minor pilin ComGF | - |
| OVA33_RS12670 (OVA33_12675) | comGG | 2444377..2444754 (+) | 378 | WP_017418138.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| OVA33_RS12675 (OVA33_12680) | - | 2444811..2444990 (+) | 180 | WP_003153093.1 | YqzE family protein | - |
| OVA33_RS12680 (OVA33_12685) | - | 2445031..2445360 (-) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| OVA33_RS12685 (OVA33_12690) | tapA | 2445619..2446290 (+) | 672 | WP_025649852.1 | amyloid fiber anchoring/assembly protein TapA | - |
| OVA33_RS12690 (OVA33_12695) | - | 2446262..2446846 (+) | 585 | WP_014418370.1 | signal peptidase I | - |
| OVA33_RS12695 (OVA33_12700) | - | 2446911..2447696 (+) | 786 | WP_017418136.1 | TasA family protein | - |
| OVA33_RS12700 (OVA33_12705) | sinR | 2447744..2448079 (-) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| OVA33_RS12705 (OVA33_12710) | sinI | 2448113..2448286 (-) | 174 | WP_014418369.1 | anti-repressor SinI family protein | Regulator |
| OVA33_RS12710 (OVA33_12715) | - | 2448463..2449257 (-) | 795 | WP_014418368.1 | YqhG family protein | - |
| OVA33_RS12715 (OVA33_12720) | - | 2449279..2450949 (-) | 1671 | WP_021494309.1 | SNF2-related protein | - |
| OVA33_RS12720 (OVA33_12725) | gcvT | 2451373..2452473 (+) | 1101 | WP_017418134.1 | glycine cleavage system aminomethyltransferase GcvT | - |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6642.60 Da Isoelectric Point: 9.8168
>NTDB_id=762542 OVA33_RS12705 WP_014418369.1 2448113..2448286(-) (sinI) [Bacillus sp. KICET-1]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=762542 OVA33_RS12705 WP_014418369.1 2448113..2448286(-) (sinI) [Bacillus sp. KICET-1]
ATGAAAAATGCAAAAACAGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAACAGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
71.93 |
100 |
0.719 |