Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | OQH41_RS03805 | Genome accession | NZ_CP113442 |
| Coordinates | 793429..793782 (+) | Length | 117 a.a. |
| NCBI ID | WP_004738307.1 | Uniprot ID | - |
| Organism | Acinetobacter baumannii strain C9 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 759976..795255 | 793429..793782 | within | 0 |
Gene organization within MGE regions
Location: 759976..795255
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OQH41_RS03590 (OQH41_03590) | - | 759976..760389 (-) | 414 | WP_005112025.1 | hypothetical protein | - |
| OQH41_RS03595 (OQH41_03595) | - | 760475..760654 (-) | 180 | WP_000009390.1 | type II toxin-antitoxin system HicA family toxin | - |
| OQH41_RS03600 (OQH41_03600) | - | 760762..760977 (-) | 216 | WP_227552920.1 | hypothetical protein | - |
| OQH41_RS03605 (OQH41_03605) | - | 760988..762034 (-) | 1047 | WP_194299481.1 | phage portal protein | - |
| OQH41_RS03610 (OQH41_03610) | - | 762031..763809 (-) | 1779 | WP_005112022.1 | terminase large subunit domain-containing protein | - |
| OQH41_RS03615 (OQH41_03615) | - | 763988..764839 (+) | 852 | WP_005112021.1 | GPO family capsid scaffolding protein | - |
| OQH41_RS03620 (OQH41_03620) | - | 764872..765882 (+) | 1011 | WP_004703735.1 | phage major capsid protein, P2 family | - |
| OQH41_RS03625 (OQH41_03625) | gpM | 765889..766653 (+) | 765 | WP_005112018.1 | phage terminase small subunit | - |
| OQH41_RS03630 (OQH41_03630) | - | 766754..767203 (+) | 450 | WP_004703731.1 | head completion/stabilization protein | - |
| OQH41_RS03635 (OQH41_03635) | - | 767200..767409 (+) | 210 | WP_005112016.1 | tail protein X | - |
| OQH41_RS03640 (OQH41_03640) | - | 767412..767771 (+) | 360 | WP_005112015.1 | putative holin | - |
| OQH41_RS03645 (OQH41_03645) | - | 767768..768025 (+) | 258 | WP_004738245.1 | phage holin family protein | - |
| OQH41_RS03650 (OQH41_03650) | - | 768022..768852 (+) | 831 | WP_005112012.1 | N-acetylmuramidase domain-containing protein | - |
| OQH41_RS03655 (OQH41_03655) | - | 768882..769379 (+) | 498 | WP_242464998.1 | phage tail protein | - |
| OQH41_RS03660 (OQH41_03660) | - | 769383..769844 (+) | 462 | WP_005112009.1 | phage virion morphogenesis protein | - |
| OQH41_RS03665 (OQH41_03665) | - | 769905..770459 (+) | 555 | WP_005112007.1 | phage baseplate assembly protein V | - |
| OQH41_RS03670 (OQH41_03670) | - | 770456..770806 (+) | 351 | WP_005112006.1 | GPW/gp25 family protein | - |
| OQH41_RS03675 (OQH41_03675) | - | 770827..771720 (+) | 894 | WP_254231394.1 | baseplate J/gp47 family protein | - |
| OQH41_RS03680 (OQH41_03680) | - | 771720..772256 (+) | 537 | WP_005112001.1 | phage tail protein I | - |
| OQH41_RS03685 (OQH41_03685) | - | 772257..775880 (+) | 3624 | WP_265615365.1 | phage tail protein | - |
| OQH41_RS03690 (OQH41_03690) | - | 775882..776379 (+) | 498 | WP_196085660.1 | hypothetical protein | - |
| OQH41_RS03695 (OQH41_03695) | - | 776488..777657 (+) | 1170 | WP_265615366.1 | phage tail sheath protein | - |
| OQH41_RS03700 (OQH41_03700) | - | 777669..778184 (+) | 516 | WP_196085661.1 | phage major tail tube protein | - |
| OQH41_RS03705 (OQH41_03705) | - | 778246..778626 (+) | 381 | WP_004738270.1 | phage tail assembly protein | - |
| OQH41_RS03710 (OQH41_03710) | - | 778686..778754 (+) | 69 | WP_238826551.1 | GpE family phage tail protein | - |
| OQH41_RS03715 (OQH41_03715) | - | 778751..782380 (+) | 3630 | WP_265615367.1 | phage tail protein | - |
| OQH41_RS03720 (OQH41_03720) | - | 782395..782814 (+) | 420 | WP_004738274.1 | phage tail protein | - |
| OQH41_RS03725 (OQH41_03725) | - | 782818..784035 (+) | 1218 | WP_265615368.1 | contractile injection system protein, VgrG/Pvc8 family | - |
| OQH41_RS03730 (OQH41_03730) | - | 784032..784823 (-) | 792 | WP_265615369.1 | DNA adenine methylase | - |
| OQH41_RS19330 | - | 784792..784983 (-) | 192 | WP_396232066.1 | Com family DNA-binding transcriptional regulator | - |
| OQH41_RS03735 (OQH41_03735) | - | 785102..785389 (+) | 288 | WP_004738277.1 | ogr/Delta-like zinc finger family protein | - |
| OQH41_RS03740 (OQH41_03740) | - | 785389..785784 (+) | 396 | WP_004738278.1 | hypothetical protein | - |
| OQH41_RS03745 (OQH41_03745) | - | 785789..786142 (+) | 354 | WP_004738279.1 | hypothetical protein | - |
| OQH41_RS03750 (OQH41_03750) | - | 786294..786461 (-) | 168 | WP_265615370.1 | hypothetical protein | - |
| OQH41_RS03755 (OQH41_03755) | - | 786877..787200 (+) | 324 | WP_004738284.1 | hypothetical protein | - |
| OQH41_RS03760 (OQH41_03760) | - | 787197..787775 (+) | 579 | WP_004738286.1 | hypothetical protein | - |
| OQH41_RS03765 (OQH41_03765) | - | 787772..788122 (-) | 351 | WP_004738288.1 | hypothetical protein | - |
| OQH41_RS03770 (OQH41_03770) | - | 788206..788406 (+) | 201 | WP_004738291.1 | hypothetical protein | - |
| OQH41_RS03775 (OQH41_03775) | - | 788409..788648 (+) | 240 | WP_004738293.1 | hypothetical protein | - |
| OQH41_RS03780 (OQH41_03780) | - | 788843..791569 (+) | 2727 | WP_004738296.1 | toprim domain-containing protein | - |
| OQH41_RS03785 (OQH41_03785) | - | 791586..792188 (+) | 603 | WP_004738299.1 | hypothetical protein | - |
| OQH41_RS03790 (OQH41_03790) | - | 792256..792774 (+) | 519 | WP_004738302.1 | hypothetical protein | - |
| OQH41_RS03795 (OQH41_03795) | - | 792778..793131 (+) | 354 | WP_004738303.1 | hypothetical protein | - |
| OQH41_RS03800 (OQH41_03800) | - | 793124..793441 (+) | 318 | WP_004738305.1 | hypothetical protein | - |
| OQH41_RS03805 (OQH41_03805) | ssb | 793429..793782 (+) | 354 | WP_004738307.1 | single-stranded DNA-binding protein | Machinery gene |
| OQH41_RS03810 (OQH41_03810) | - | 793803..794006 (+) | 204 | WP_004738309.1 | hypothetical protein | - |
| OQH41_RS03815 (OQH41_03815) | - | 794095..795255 (+) | 1161 | WP_004738311.1 | tyrosine-type recombinase/integrase | - |
Sequence
Protein
Download Length: 117 a.a. Molecular weight: 13204.83 Da Isoelectric Point: 9.8037
>NTDB_id=762337 OQH41_RS03805 WP_004738307.1 793429..793782(+) (ssb) [Acinetobacter baumannii strain C9]
MRGINKVILVGSLGANPITKHYPNGNTYVQFSIATSEKYQDKNTGEWIENTEWHRIIAYGRLGEVATQILKKGSKVYVEG
SLRTRQVTDQRGQQGYITEVRANTFQSLDSLPQANPY
MRGINKVILVGSLGANPITKHYPNGNTYVQFSIATSEKYQDKNTGEWIENTEWHRIIAYGRLGEVATQILKKGSKVYVEG
SLRTRQVTDQRGQQGYITEVRANTFQSLDSLPQANPY
Nucleotide
Download Length: 354 bp
>NTDB_id=762337 OQH41_RS03805 WP_004738307.1 793429..793782(+) (ssb) [Acinetobacter baumannii strain C9]
ATGCGCGGGATAAATAAAGTCATTCTTGTGGGAAGTTTAGGTGCAAATCCAATAACCAAACATTACCCGAACGGTAATAC
TTACGTTCAGTTTTCGATTGCTACTTCAGAAAAGTATCAAGATAAAAACACAGGTGAATGGATTGAGAATACGGAATGGC
ATCGAATTATTGCATACGGTCGATTAGGTGAGGTTGCCACTCAAATCTTAAAAAAAGGTTCAAAAGTTTATGTAGAGGGT
TCTTTACGAACAAGACAAGTTACCGACCAAAGAGGTCAGCAAGGTTATATAACCGAAGTAAGGGCAAACACCTTTCAGTC
TTTAGATAGCCTTCCGCAAGCAAACCCTTATTAA
ATGCGCGGGATAAATAAAGTCATTCTTGTGGGAAGTTTAGGTGCAAATCCAATAACCAAACATTACCCGAACGGTAATAC
TTACGTTCAGTTTTCGATTGCTACTTCAGAAAAGTATCAAGATAAAAACACAGGTGAATGGATTGAGAATACGGAATGGC
ATCGAATTATTGCATACGGTCGATTAGGTGAGGTTGCCACTCAAATCTTAAAAAAAGGTTCAAAAGTTTATGTAGAGGGT
TCTTTACGAACAAGACAAGTTACCGACCAAAGAGGTCAGCAAGGTTATATAACCGAAGTAAGGGCAAACACCTTTCAGTC
TTTAGATAGCCTTCCGCAAGCAAACCCTTATTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Glaesserella parasuis strain SC1401 |
54.545 |
94.017 |
0.513 |
| ssb | Vibrio cholerae strain A1552 |
54.545 |
84.615 |
0.462 |
| ssb | Neisseria gonorrhoeae MS11 |
42.857 |
89.744 |
0.385 |
| ssb | Neisseria meningitidis MC58 |
42.857 |
89.744 |
0.385 |