Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | ORU23_RS00395 | Genome accession | NZ_CP113236 |
| Coordinates | 65343..65795 (-) | Length | 150 a.a. |
| NCBI ID | WP_078801814.1 | Uniprot ID | - |
| Organism | Pasteurella multocida strain PF8 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 45689..108314 | 65343..65795 | within | 0 |
Gene organization within MGE regions
Location: 45689..108314
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ORU23_RS00255 (ORU23_00255) | - | 45689..46726 (-) | 1038 | WP_225529672.1 | tyrosine-type recombinase/integrase | - |
| ORU23_RS00260 (ORU23_00260) | - | 46735..47121 (-) | 387 | WP_016533425.1 | hypothetical protein | - |
| ORU23_RS00265 (ORU23_00265) | - | 47237..47692 (-) | 456 | WP_014390696.1 | hypothetical protein | - |
| ORU23_RS00270 (ORU23_00270) | - | 47737..48090 (-) | 354 | WP_078801811.1 | hypothetical protein | - |
| ORU23_RS00275 (ORU23_00275) | - | 48099..48626 (-) | 528 | WP_078801812.1 | DUF551 domain-containing protein | - |
| ORU23_RS00280 (ORU23_00280) | rdgC | 48770..49672 (-) | 903 | Protein_51 | recombination-associated protein RdgC | - |
| ORU23_RS00285 (ORU23_00285) | - | 49675..50058 (-) | 384 | WP_078801813.1 | hypothetical protein | - |
| ORU23_RS00290 (ORU23_00290) | - | 50137..50448 (-) | 312 | WP_014390701.1 | DUF6378 domain-containing protein | - |
| ORU23_RS00295 (ORU23_00295) | - | 50448..50969 (-) | 522 | WP_014390702.1 | MazG-like family protein | - |
| ORU23_RS00300 (ORU23_00300) | - | 51260..51472 (-) | 213 | WP_005628486.1 | Gfo/Idh/MocA family oxidoreductase | - |
| ORU23_RS00305 (ORU23_00305) | - | 51568..52254 (-) | 687 | WP_041422865.1 | DUF4405 domain-containing protein | - |
| ORU23_RS00310 (ORU23_00310) | - | 52304..52597 (-) | 294 | WP_005612106.1 | flavodoxin | - |
| ORU23_RS00315 (ORU23_00315) | - | 52511..52900 (+) | 390 | WP_076090694.1 | IS1 family transposase | - |
| ORU23_RS00320 (ORU23_00320) | - | 52954..53103 (+) | 150 | Protein_59 | arsenical-resistance protein | - |
| ORU23_RS00325 (ORU23_00325) | - | 53173..54720 (-) | 1548 | WP_010907408.1 | multicopper oxidase family protein | - |
| ORU23_RS00330 (ORU23_00330) | - | 54732..55187 (-) | 456 | WP_010907409.1 | DUF411 domain-containing protein | - |
| ORU23_RS00335 (ORU23_00335) | - | 55224..55901 (+) | 678 | WP_016533871.1 | zinc-binding dehydrogenase | - |
| ORU23_RS00340 (ORU23_00340) | - | 55954..56313 (-) | 360 | Protein_63 | arsenical-resistance protein | - |
| ORU23_RS00345 (ORU23_00345) | - | 56328..56726 (-) | 399 | WP_010907411.1 | Cd(II)/Pb(II)-responsive transcriptional regulator | - |
| ORU23_RS00350 (ORU23_00350) | - | 56799..57413 (+) | 615 | WP_010907412.1 | cation diffusion facilitator family transporter | - |
| ORU23_RS00355 (ORU23_00355) | arsB | 57497..58513 (-) | 1017 | WP_010907413.1 | ACR3 family arsenite efflux transporter | - |
| ORU23_RS00360 (ORU23_00360) | arsC | 58517..58921 (-) | 405 | WP_010907414.1 | arsenate reductase (glutaredoxin) | - |
| ORU23_RS00365 (ORU23_00365) | - | 58986..59288 (-) | 303 | WP_014550505.1 | ArsR/SmtB family transcription factor | - |
| ORU23_RS00370 (ORU23_00370) | - | 59335..59709 (+) | 375 | WP_225529671.1 | LysR family transcriptional regulator | - |
| ORU23_RS00375 (ORU23_00375) | - | 59955..60365 (-) | 411 | WP_010907416.1 | hypothetical protein | - |
| ORU23_RS00380 (ORU23_00380) | - | 60367..62403 (-) | 2037 | WP_010907417.1 | integrase | - |
| ORU23_RS00385 (ORU23_00385) | - | 62406..63926 (-) | 1521 | WP_010907418.1 | site-specific integrase | - |
| ORU23_RS00390 (ORU23_00390) | - | 63913..65193 (-) | 1281 | WP_016533798.1 | site-specific integrase | - |
| ORU23_RS00395 (ORU23_00395) | ssb | 65343..65795 (-) | 453 | WP_078801814.1 | single-stranded DNA-binding protein | Machinery gene |
| ORU23_RS00400 (ORU23_00400) | - | 65795..66454 (-) | 660 | WP_266212962.1 | translocation protein TolB precursor | - |
| ORU23_RS00405 (ORU23_00405) | - | 66441..67394 (-) | 954 | WP_014391451.1 | recombinase RecT | - |
| ORU23_RS00410 (ORU23_00410) | - | 67396..67683 (-) | 288 | WP_014391452.1 | hypothetical protein | - |
| ORU23_RS00415 (ORU23_00415) | - | 67696..67932 (-) | 237 | WP_078801815.1 | hypothetical protein | - |
| ORU23_RS00420 (ORU23_00420) | - | 67904..68203 (-) | 300 | WP_266208799.1 | hypothetical protein | - |
| ORU23_RS00425 (ORU23_00425) | - | 68351..68581 (+) | 231 | WP_223251317.1 | hypothetical protein | - |
| ORU23_RS00430 (ORU23_00430) | - | 68644..69285 (-) | 642 | WP_078801817.1 | Bro-N domain-containing protein | - |
| ORU23_RS00435 (ORU23_00435) | - | 69567..70109 (-) | 543 | WP_078737823.1 | DUF4760 domain-containing protein | - |
| ORU23_RS00440 (ORU23_00440) | - | 70753..70947 (+) | 195 | WP_078737822.1 | hypothetical protein | - |
| ORU23_RS00445 (ORU23_00445) | - | 70928..71098 (-) | 171 | WP_155295599.1 | hypothetical protein | - |
| ORU23_RS00450 (ORU23_00450) | - | 71111..71341 (-) | 231 | WP_078737821.1 | hypothetical protein | - |
| ORU23_RS00455 (ORU23_00455) | - | 71583..71792 (-) | 210 | WP_005756656.1 | hypothetical protein | - |
| ORU23_RS00460 (ORU23_00460) | - | 71805..71972 (+) | 168 | WP_005756653.1 | YegP family protein | - |
| ORU23_RS00465 (ORU23_00465) | - | 72328..73152 (-) | 825 | WP_014390716.1 | DUF3037 domain-containing protein | - |
| ORU23_RS00470 (ORU23_00470) | - | 73149..73886 (-) | 738 | WP_014390717.1 | HipA family kinase | - |
| ORU23_RS00475 (ORU23_00475) | - | 73962..74648 (-) | 687 | WP_014391464.1 | XRE family transcriptional regulator | - |
| ORU23_RS00480 (ORU23_00480) | - | 74776..74985 (+) | 210 | WP_005720263.1 | helix-turn-helix transcriptional regulator | - |
| ORU23_RS00485 (ORU23_00485) | - | 75034..75486 (+) | 453 | WP_014391466.1 | phage regulatory CII family protein | - |
| ORU23_RS00490 (ORU23_00490) | - | 75545..76246 (+) | 702 | WP_014667788.1 | phage antirepressor KilAC domain-containing protein | - |
| ORU23_RS00495 (ORU23_00495) | - | 76243..76596 (+) | 354 | WP_014390722.1 | HNH endonuclease | - |
| ORU23_RS00500 (ORU23_00500) | - | 76598..77569 (+) | 972 | WP_266212964.1 | hypothetical protein | - |
| ORU23_RS00505 (ORU23_00505) | - | 77569..78264 (+) | 696 | WP_078801819.1 | replication protein P | - |
| ORU23_RS00510 (ORU23_00510) | - | 78257..78787 (+) | 531 | WP_078801820.1 | MT-A70 family methyltransferase | - |
| ORU23_RS00515 (ORU23_00515) | - | 78796..79233 (+) | 438 | WP_064965060.1 | DUF1367 family protein | - |
| ORU23_RS00520 (ORU23_00520) | - | 79393..79608 (+) | 216 | WP_078801821.1 | hypothetical protein | - |
| ORU23_RS00525 (ORU23_00525) | - | 79601..80203 (+) | 603 | WP_266208798.1 | recombination protein NinG | - |
| ORU23_RS00530 (ORU23_00530) | - | 80205..80666 (+) | 462 | WP_078801823.1 | antiterminator Q family protein | - |
| ORU23_RS00540 (ORU23_00540) | - | 80993..81253 (+) | 261 | WP_014391475.1 | HP1 family phage holin | - |
| ORU23_RS00545 (ORU23_00545) | - | 81250..81780 (+) | 531 | WP_266212965.1 | lysozyme | - |
| ORU23_RS00550 (ORU23_00550) | - | 81753..82076 (+) | 324 | WP_078801840.1 | DUF2570 family protein | - |
| ORU23_RS00555 (ORU23_00555) | - | 82298..82732 (-) | 435 | WP_014390736.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| ORU23_RS00560 (ORU23_00560) | - | 82761..82943 (-) | 183 | WP_016533497.1 | type II toxin-antitoxin system HicA family toxin | - |
| ORU23_RS00565 (ORU23_00565) | - | 83026..83523 (+) | 498 | WP_014390737.1 | terminase | - |
| ORU23_RS00570 (ORU23_00570) | - | 83507..84733 (+) | 1227 | WP_078801824.1 | PBSX family phage terminase large subunit | - |
| ORU23_RS00575 (ORU23_00575) | - | 84748..86193 (+) | 1446 | WP_014390739.1 | anti-CBASS protein Acb1 family protein | - |
| ORU23_RS00580 (ORU23_00580) | - | 86147..87118 (+) | 972 | WP_014390740.1 | phage minor head protein | - |
| ORU23_RS00585 (ORU23_00585) | - | 87133..88479 (+) | 1347 | WP_014390741.1 | DUF2213 domain-containing protein | - |
| ORU23_RS00590 (ORU23_00590) | - | 88479..88913 (+) | 435 | WP_014390742.1 | hypothetical protein | - |
| ORU23_RS00595 (ORU23_00595) | - | 89000..89923 (+) | 924 | WP_250021448.1 | major capsid protein | - |
| ORU23_RS00600 (ORU23_00600) | - | 89934..90275 (+) | 342 | WP_156707171.1 | hypothetical protein | - |
| ORU23_RS00605 (ORU23_00605) | - | 90256..90624 (+) | 369 | WP_014390745.1 | hypothetical protein | - |
| ORU23_RS00610 (ORU23_00610) | - | 90627..90971 (+) | 345 | WP_014390746.1 | hypothetical protein | - |
| ORU23_RS00615 (ORU23_00615) | - | 90976..91347 (+) | 372 | WP_014390747.1 | hypothetical protein | - |
| ORU23_RS00620 (ORU23_00620) | - | 91344..91715 (+) | 372 | WP_014390748.1 | hypothetical protein | - |
| ORU23_RS00625 (ORU23_00625) | - | 91727..92209 (+) | 483 | WP_014390749.1 | phage tail tube protein | - |
| ORU23_RS00630 (ORU23_00630) | - | 92263..92934 (+) | 672 | WP_014390750.1 | DUF6246 family protein | - |
| ORU23_RS00635 (ORU23_00635) | - | 93011..93367 (+) | 357 | WP_014390751.1 | TM2 domain-containing protein | - |
| ORU23_RS00640 (ORU23_00640) | - | 93443..94261 (-) | 819 | WP_014390752.1 | hypothetical protein | - |
| ORU23_RS00645 (ORU23_00645) | - | 94600..95424 (+) | 825 | WP_014390754.1 | phage antirepressor N-terminal domain-containing protein | - |
| ORU23_RS00650 (ORU23_00650) | - | 95476..97920 (+) | 2445 | WP_014390755.1 | phage tail length tape measure family protein | - |
| ORU23_RS00655 (ORU23_00655) | - | 97923..98252 (+) | 330 | WP_014390756.1 | phage tail protein | - |
| ORU23_RS00660 (ORU23_00660) | - | 98381..99085 (+) | 705 | WP_078801828.1 | phage minor tail protein L | - |
| ORU23_RS00665 (ORU23_00665) | - | 99090..99833 (+) | 744 | WP_078801829.1 | C40 family peptidase | - |
| ORU23_RS00670 (ORU23_00670) | - | 99776..100396 (+) | 621 | WP_014667799.1 | tail assembly protein | - |
| ORU23_RS00675 (ORU23_00675) | - | 100400..106294 (+) | 5895 | WP_267929185.1 | phage tail protein | - |
| ORU23_RS00680 (ORU23_00680) | - | 106342..106665 (+) | 324 | WP_014667801.1 | hypothetical protein | - |
| ORU23_RS00685 (ORU23_00685) | - | 107056..107802 (-) | 747 | WP_014390762.1 | hypothetical protein | - |
| ORU23_RS00690 (ORU23_00690) | - | 107802..108314 (-) | 513 | WP_014390763.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 150 a.a. Molecular weight: 17107.99 Da Isoelectric Point: 7.9707
>NTDB_id=761059 ORU23_RS00395 WP_078801814.1 65343..65795(-) (ssb) [Pasteurella multocida strain PF8]
MAGVNRVIILGNLGSDPEIRTMPNGDPVAKISVATSESWIDKNTNERKTQTEWHSIVFYRRQAEICGQYLKKGSKVYVEG
KLRTRKWQDQNGQDRYTTEIQGDVLQMLDSRQDSQQQQAQAPQNNAYANAKAGKPVQQQAYNFEEDNIPF
MAGVNRVIILGNLGSDPEIRTMPNGDPVAKISVATSESWIDKNTNERKTQTEWHSIVFYRRQAEICGQYLKKGSKVYVEG
KLRTRKWQDQNGQDRYTTEIQGDVLQMLDSRQDSQQQQAQAPQNNAYANAKAGKPVQQQAYNFEEDNIPF
Nucleotide
Download Length: 453 bp
>NTDB_id=761059 ORU23_RS00395 WP_078801814.1 65343..65795(-) (ssb) [Pasteurella multocida strain PF8]
ATGGCTGGGGTTAATCGTGTAATTATTTTAGGAAATTTAGGAAGCGATCCTGAAATCCGCACAATGCCAAATGGCGACCC
TGTGGCAAAAATCAGTGTGGCCACAAGTGAAAGCTGGATTGATAAAAACACAAACGAACGAAAAACACAAACTGAATGGC
ATTCTATCGTGTTCTATCGTCGCCAAGCAGAAATTTGCGGGCAGTATTTGAAGAAAGGCTCGAAAGTTTATGTGGAAGGT
AAGCTCAGAACACGCAAATGGCAAGATCAAAATGGTCAAGACCGCTACACCACAGAGATTCAAGGCGACGTATTACAAAT
GCTAGACAGTCGCCAAGATTCACAGCAACAGCAAGCACAGGCACCACAAAATAATGCTTATGCGAATGCGAAAGCTGGAA
AGCCTGTACAGCAACAAGCATATAACTTTGAAGAGGATAATATCCCATTCTGA
ATGGCTGGGGTTAATCGTGTAATTATTTTAGGAAATTTAGGAAGCGATCCTGAAATCCGCACAATGCCAAATGGCGACCC
TGTGGCAAAAATCAGTGTGGCCACAAGTGAAAGCTGGATTGATAAAAACACAAACGAACGAAAAACACAAACTGAATGGC
ATTCTATCGTGTTCTATCGTCGCCAAGCAGAAATTTGCGGGCAGTATTTGAAGAAAGGCTCGAAAGTTTATGTGGAAGGT
AAGCTCAGAACACGCAAATGGCAAGATCAAAATGGTCAAGACCGCTACACCACAGAGATTCAAGGCGACGTATTACAAAT
GCTAGACAGTCGCCAAGATTCACAGCAACAGCAAGCACAGGCACCACAAAATAATGCTTATGCGAATGCGAAAGCTGGAA
AGCCTGTACAGCAACAAGCATATAACTTTGAAGAGGATAATATCCCATTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Glaesserella parasuis strain SC1401 |
60.556 |
100 |
0.727 |
| ssb | Vibrio cholerae strain A1552 |
52.518 |
92.667 |
0.487 |
| ssb | Neisseria gonorrhoeae MS11 |
44.526 |
91.333 |
0.407 |
| ssb | Neisseria meningitidis MC58 |
44.526 |
91.333 |
0.407 |