Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | OSV62_RS02700 | Genome accession | NZ_CP113080 |
| Coordinates | 549247..549600 (-) | Length | 117 a.a. |
| NCBI ID | WP_002014678.1 | Uniprot ID | A0A0D5YEH0 |
| Organism | Acinetobacter baumannii strain AB5075-T | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 546881..581019 | 549247..549600 | within | 0 |
Gene organization within MGE regions
Location: 546881..581019
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OSV62_RS02680 (OSV62_02680) | - | 546881..547948 (+) | 1068 | WP_000107855.1 | tyrosine-type recombinase/integrase | - |
| OSV62_RS02685 (OSV62_02685) | - | 547976..548272 (-) | 297 | WP_000218943.1 | hypothetical protein | - |
| OSV62_RS02690 (OSV62_02690) | - | 548269..548490 (-) | 222 | WP_000424605.1 | hypothetical protein | - |
| OSV62_RS02695 (OSV62_02695) | - | 548500..549237 (-) | 738 | WP_000125747.1 | 3'-5' exonuclease | - |
| OSV62_RS02700 (OSV62_02700) | ssb | 549247..549600 (-) | 354 | WP_002014678.1 | single-stranded DNA-binding protein | Machinery gene |
| OSV62_RS02705 (OSV62_02705) | - | 549588..549905 (-) | 318 | WP_000049658.1 | hypothetical protein | - |
| OSV62_RS02710 (OSV62_02710) | - | 549898..550068 (-) | 171 | WP_001015076.1 | hypothetical protein | - |
| OSV62_RS02715 (OSV62_02715) | - | 550058..550609 (-) | 552 | WP_001178668.1 | hypothetical protein | - |
| OSV62_RS02720 (OSV62_02720) | - | 550675..551007 (-) | 333 | WP_000632296.1 | hypothetical protein | - |
| OSV62_RS02725 (OSV62_02725) | - | 551004..553742 (-) | 2739 | WP_002014340.1 | toprim domain-containing protein | - |
| OSV62_RS02730 (OSV62_02730) | - | 553836..554027 (-) | 192 | WP_001043481.1 | hypothetical protein | - |
| OSV62_RS02735 (OSV62_02735) | - | 554120..554461 (+) | 342 | WP_000786719.1 | helix-turn-helix domain-containing protein | - |
| OSV62_RS02740 (OSV62_02740) | - | 554506..554721 (-) | 216 | WP_000556351.1 | hypothetical protein | - |
| OSV62_RS02745 (OSV62_02745) | - | 554846..555661 (-) | 816 | WP_001094886.1 | Rha family transcriptional regulator | - |
| OSV62_RS02750 (OSV62_02750) | - | 555769..555963 (-) | 195 | WP_000696053.1 | hypothetical protein | - |
| OSV62_RS02755 (OSV62_02755) | - | 556273..557151 (+) | 879 | WP_000417952.1 | BRCT domain-containing protein | - |
| OSV62_RS02760 (OSV62_02760) | - | 557151..557432 (+) | 282 | WP_000713873.1 | hypothetical protein | - |
| OSV62_RS02765 (OSV62_02765) | - | 557748..557948 (-) | 201 | WP_000130085.1 | TraR/DksA C4-type zinc finger protein | - |
| OSV62_RS02770 (OSV62_02770) | - | 557945..558184 (-) | 240 | WP_000113725.1 | ogr/Delta-like zinc finger family protein | - |
| OSV62_RS02775 (OSV62_02775) | - | 558314..559627 (-) | 1314 | WP_000483061.1 | contractile injection system protein, VgrG/Pvc8 family | - |
| OSV62_RS02780 (OSV62_02780) | - | 559628..560068 (-) | 441 | WP_000979757.1 | phage tail protein | - |
| OSV62_RS02785 (OSV62_02785) | - | 560074..562524 (-) | 2451 | WP_000774268.1 | phage tail tape measure protein | - |
| OSV62_RS02795 (OSV62_02795) | - | 563799..564620 (+) | 822 | WP_001046004.1 | OXA-23 family carbapenem-hydrolyzing class D beta-lactamase OXA-23 | - |
| OSV62_RS02800 (OSV62_02800) | - | 564725..565423 (-) | 699 | Protein_531 | ATP-binding protein | - |
| OSV62_RS02805 (OSV62_02805) | - | 565480..565821 (-) | 342 | WP_001071615.1 | phage tail assembly protein | - |
| OSV62_RS02810 (OSV62_02810) | - | 565888..566406 (-) | 519 | WP_001207612.1 | phage major tail tube protein | - |
| OSV62_RS02815 (OSV62_02815) | - | 566419..567594 (-) | 1176 | WP_000963361.1 | phage tail sheath protein | - |
| OSV62_RS02820 (OSV62_02820) | - | 567744..569696 (-) | 1953 | WP_000729646.1 | phage tail protein | - |
| OSV62_RS02825 (OSV62_02825) | - | 569708..570313 (-) | 606 | WP_001050805.1 | phage tail protein I | - |
| OSV62_RS02830 (OSV62_02830) | - | 570313..571215 (-) | 903 | WP_000109738.1 | baseplate J/gp47 family protein | - |
| OSV62_RS02835 (OSV62_02835) | - | 571212..571559 (-) | 348 | WP_000987745.1 | GPW/gp25 family protein | - |
| OSV62_RS02840 (OSV62_02840) | - | 571556..572188 (-) | 633 | WP_000990625.1 | phage baseplate assembly protein V | - |
| OSV62_RS02845 (OSV62_02845) | - | 572261..572710 (-) | 450 | WP_001059843.1 | phage virion morphogenesis protein | - |
| OSV62_RS02850 (OSV62_02850) | - | 572707..573234 (-) | 528 | WP_000742888.1 | phage tail protein | - |
| OSV62_RS02855 (OSV62_02855) | - | 573231..574061 (-) | 831 | WP_000600982.1 | N-acetylmuramidase domain-containing protein | - |
| OSV62_RS02860 (OSV62_02860) | - | 574058..574327 (-) | 270 | WP_000571491.1 | phage holin family protein | - |
| OSV62_RS02865 (OSV62_02865) | - | 574324..574674 (-) | 351 | WP_001114936.1 | putative holin | - |
| OSV62_RS02870 (OSV62_02870) | - | 574683..574892 (-) | 210 | WP_000659474.1 | tail protein X | - |
| OSV62_RS02875 (OSV62_02875) | - | 574893..575345 (-) | 453 | WP_000015691.1 | head completion/stabilization protein | - |
| OSV62_RS02880 (OSV62_02880) | gpM | 575449..576195 (-) | 747 | WP_000950641.1 | phage terminase small subunit | - |
| OSV62_RS02885 (OSV62_02885) | - | 576206..577195 (-) | 990 | WP_001243259.1 | phage major capsid protein, P2 family | - |
| OSV62_RS02890 (OSV62_02890) | - | 577248..578075 (-) | 828 | WP_000748563.1 | GPO family capsid scaffolding protein | - |
| OSV62_RS02895 (OSV62_02895) | - | 578234..580021 (+) | 1788 | WP_031946558.1 | terminase large subunit domain-containing protein | - |
| OSV62_RS02900 (OSV62_02900) | - | 580021..581019 (+) | 999 | WP_001284079.1 | phage portal protein | - |
Sequence
Protein
Download Length: 117 a.a. Molecular weight: 13365.13 Da Isoelectric Point: 9.7939
>NTDB_id=760052 OSV62_RS02700 WP_002014678.1 549247..549600(-) (ssb) [Acinetobacter baumannii strain AB5075-T]
MRGINKVILVGMLGANPIPKQFQNGGSYAQFSIATSEKYQDKRTGDWIENTEWHRIVAHNRLGEIACQFLKKGSKVYIEG
SLHTRKWTDQNNQERYVTEVRAITFQSLDSLPQANPV
MRGINKVILVGMLGANPIPKQFQNGGSYAQFSIATSEKYQDKRTGDWIENTEWHRIVAHNRLGEIACQFLKKGSKVYIEG
SLHTRKWTDQNNQERYVTEVRAITFQSLDSLPQANPV
Nucleotide
Download Length: 354 bp
>NTDB_id=760052 OSV62_RS02700 WP_002014678.1 549247..549600(-) (ssb) [Acinetobacter baumannii strain AB5075-T]
ATGCGCGGAATAAATAAAGTGATCTTGGTTGGAATGCTTGGTGCTAACCCAATTCCTAAACAATTTCAAAACGGTGGCTC
CTATGCTCAGTTTTCAATTGCCACTTCAGAAAAATACCAGGACAAACGCACTGGAGATTGGATTGAAAATACTGAGTGGC
ATCGGATTGTGGCTCACAACCGCCTAGGTGAAATTGCCTGTCAATTTCTCAAAAAAGGTTCAAAAGTTTATATCGAAGGC
TCATTACATACCCGGAAATGGACTGACCAAAATAATCAAGAACGTTACGTAACTGAAGTTAGAGCCATTACATTTCAATC
GCTCGATAGCTTGCCACAAGCAAACCCGGTTTAA
ATGCGCGGAATAAATAAAGTGATCTTGGTTGGAATGCTTGGTGCTAACCCAATTCCTAAACAATTTCAAAACGGTGGCTC
CTATGCTCAGTTTTCAATTGCCACTTCAGAAAAATACCAGGACAAACGCACTGGAGATTGGATTGAAAATACTGAGTGGC
ATCGGATTGTGGCTCACAACCGCCTAGGTGAAATTGCCTGTCAATTTCTCAAAAAAGGTTCAAAAGTTTATATCGAAGGC
TCATTACATACCCGGAAATGGACTGACCAAAATAATCAAGAACGTTACGTAACTGAAGTTAGAGCCATTACATTTCAATC
GCTCGATAGCTTGCCACAAGCAAACCCGGTTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Glaesserella parasuis strain SC1401 |
55.455 |
94.017 |
0.521 |
| ssb | Vibrio cholerae strain A1552 |
54.545 |
84.615 |
0.462 |
| ssb | Neisseria gonorrhoeae MS11 |
42.857 |
89.744 |
0.385 |
| ssb | Neisseria meningitidis MC58 |
42.857 |
89.744 |
0.385 |