Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | OSV63_RS07320 | Genome accession | NZ_CP113078 |
| Coordinates | 1472198..1472551 (+) | Length | 117 a.a. |
| NCBI ID | WP_002014678.1 | Uniprot ID | A0A0D5YEH0 |
| Organism | Acinetobacter baumannii strain AB5075 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1440779..1474917 | 1472198..1472551 | within | 0 |
Gene organization within MGE regions
Location: 1440779..1474917
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OSV63_RS07115 (OSV63_07115) | - | 1440779..1441777 (-) | 999 | WP_001284079.1 | phage portal protein | - |
| OSV63_RS07120 (OSV63_07120) | - | 1441777..1443564 (-) | 1788 | WP_031946558.1 | terminase large subunit domain-containing protein | - |
| OSV63_RS07125 (OSV63_07125) | - | 1443723..1444550 (+) | 828 | WP_000748563.1 | GPO family capsid scaffolding protein | - |
| OSV63_RS07130 (OSV63_07130) | - | 1444603..1445592 (+) | 990 | WP_001243259.1 | phage major capsid protein, P2 family | - |
| OSV63_RS07135 (OSV63_07135) | gpM | 1445603..1446349 (+) | 747 | WP_000950641.1 | phage terminase small subunit | - |
| OSV63_RS07140 (OSV63_07140) | - | 1446453..1446905 (+) | 453 | WP_000015691.1 | head completion/stabilization protein | - |
| OSV63_RS07145 (OSV63_07145) | - | 1446906..1447115 (+) | 210 | WP_000659474.1 | tail protein X | - |
| OSV63_RS07150 (OSV63_07150) | - | 1447124..1447474 (+) | 351 | WP_001114936.1 | putative holin | - |
| OSV63_RS07155 (OSV63_07155) | - | 1447471..1447740 (+) | 270 | WP_000571491.1 | phage holin family protein | - |
| OSV63_RS07160 (OSV63_07160) | - | 1447737..1448567 (+) | 831 | WP_000600982.1 | N-acetylmuramidase domain-containing protein | - |
| OSV63_RS07165 (OSV63_07165) | - | 1448564..1449091 (+) | 528 | WP_000742888.1 | phage tail protein | - |
| OSV63_RS07170 (OSV63_07170) | - | 1449088..1449537 (+) | 450 | WP_001059843.1 | phage virion morphogenesis protein | - |
| OSV63_RS07175 (OSV63_07175) | - | 1449610..1450242 (+) | 633 | WP_000990625.1 | phage baseplate assembly protein V | - |
| OSV63_RS07180 (OSV63_07180) | - | 1450239..1450586 (+) | 348 | WP_000987745.1 | GPW/gp25 family protein | - |
| OSV63_RS07185 (OSV63_07185) | - | 1450583..1451485 (+) | 903 | WP_000109738.1 | baseplate J/gp47 family protein | - |
| OSV63_RS07190 (OSV63_07190) | - | 1451485..1452090 (+) | 606 | WP_001050805.1 | phage tail protein I | - |
| OSV63_RS07195 (OSV63_07195) | - | 1452102..1454054 (+) | 1953 | WP_000729646.1 | phage tail protein | - |
| OSV63_RS07200 (OSV63_07200) | - | 1454204..1455379 (+) | 1176 | WP_000963361.1 | phage tail sheath protein | - |
| OSV63_RS07205 (OSV63_07205) | - | 1455392..1455910 (+) | 519 | WP_001207612.1 | phage major tail tube protein | - |
| OSV63_RS07210 (OSV63_07210) | - | 1455977..1456318 (+) | 342 | WP_001071615.1 | phage tail assembly protein | - |
| OSV63_RS07220 (OSV63_07220) | - | 1456354..1457073 (+) | 720 | WP_100222614.1 | DUF815 domain-containing protein | - |
| OSV63_RS07225 (OSV63_07225) | - | 1457178..1457999 (-) | 822 | WP_001046004.1 | OXA-23 family carbapenem-hydrolyzing class D beta-lactamase OXA-23 | - |
| OSV63_RS07230 (OSV63_07230) | - | 1458098..1459188 (+) | 1091 | WP_085940648.1 | IS4-like element ISAba1 family transposase | - |
| OSV63_RS07235 (OSV63_07235) | - | 1459274..1461724 (+) | 2451 | WP_000774268.1 | phage tail tape measure protein | - |
| OSV63_RS07240 (OSV63_07240) | - | 1461730..1462170 (+) | 441 | WP_000979757.1 | phage tail protein | - |
| OSV63_RS07245 (OSV63_07245) | - | 1462171..1463484 (+) | 1314 | WP_000483061.1 | contractile injection system protein, VgrG/Pvc8 family | - |
| OSV63_RS07250 (OSV63_07250) | - | 1463614..1463853 (+) | 240 | WP_000113725.1 | ogr/Delta-like zinc finger family protein | - |
| OSV63_RS07255 (OSV63_07255) | - | 1463850..1464050 (+) | 201 | WP_000130085.1 | TraR/DksA C4-type zinc finger protein | - |
| OSV63_RS07260 (OSV63_07260) | - | 1464366..1464647 (-) | 282 | WP_000713873.1 | hypothetical protein | - |
| OSV63_RS07265 (OSV63_07265) | - | 1464647..1465525 (-) | 879 | WP_000417952.1 | BRCT domain-containing protein | - |
| OSV63_RS07270 (OSV63_07270) | - | 1465835..1466029 (+) | 195 | WP_000696053.1 | hypothetical protein | - |
| OSV63_RS07275 (OSV63_07275) | - | 1466137..1466952 (+) | 816 | WP_001094886.1 | Rha family transcriptional regulator | - |
| OSV63_RS07280 (OSV63_07280) | - | 1467077..1467292 (+) | 216 | WP_000556351.1 | hypothetical protein | - |
| OSV63_RS07285 (OSV63_07285) | - | 1467337..1467678 (-) | 342 | WP_000786719.1 | helix-turn-helix domain-containing protein | - |
| OSV63_RS07290 (OSV63_07290) | - | 1467771..1467962 (+) | 192 | WP_001043481.1 | hypothetical protein | - |
| OSV63_RS07295 (OSV63_07295) | - | 1468056..1470794 (+) | 2739 | WP_002014340.1 | toprim domain-containing protein | - |
| OSV63_RS07300 (OSV63_07300) | - | 1470791..1471123 (+) | 333 | WP_000632296.1 | hypothetical protein | - |
| OSV63_RS07305 (OSV63_07305) | - | 1471189..1471740 (+) | 552 | WP_001178668.1 | hypothetical protein | - |
| OSV63_RS07310 (OSV63_07310) | - | 1471730..1471900 (+) | 171 | WP_001015076.1 | hypothetical protein | - |
| OSV63_RS07315 (OSV63_07315) | - | 1471893..1472210 (+) | 318 | WP_000049658.1 | hypothetical protein | - |
| OSV63_RS07320 (OSV63_07320) | ssb | 1472198..1472551 (+) | 354 | WP_002014678.1 | single-stranded DNA-binding protein | Machinery gene |
| OSV63_RS07325 (OSV63_07325) | - | 1472561..1473298 (+) | 738 | WP_000125747.1 | 3'-5' exonuclease | - |
| OSV63_RS07330 (OSV63_07330) | - | 1473308..1473529 (+) | 222 | WP_000424605.1 | hypothetical protein | - |
| OSV63_RS07335 (OSV63_07335) | - | 1473526..1473822 (+) | 297 | WP_000218943.1 | hypothetical protein | - |
| OSV63_RS07340 (OSV63_07340) | - | 1473850..1474917 (-) | 1068 | WP_000107855.1 | tyrosine-type recombinase/integrase | - |
Sequence
Protein
Download Length: 117 a.a. Molecular weight: 13365.13 Da Isoelectric Point: 9.7939
>NTDB_id=759994 OSV63_RS07320 WP_002014678.1 1472198..1472551(+) (ssb) [Acinetobacter baumannii strain AB5075]
MRGINKVILVGMLGANPIPKQFQNGGSYAQFSIATSEKYQDKRTGDWIENTEWHRIVAHNRLGEIACQFLKKGSKVYIEG
SLHTRKWTDQNNQERYVTEVRAITFQSLDSLPQANPV
MRGINKVILVGMLGANPIPKQFQNGGSYAQFSIATSEKYQDKRTGDWIENTEWHRIVAHNRLGEIACQFLKKGSKVYIEG
SLHTRKWTDQNNQERYVTEVRAITFQSLDSLPQANPV
Nucleotide
Download Length: 354 bp
>NTDB_id=759994 OSV63_RS07320 WP_002014678.1 1472198..1472551(+) (ssb) [Acinetobacter baumannii strain AB5075]
ATGCGCGGAATAAATAAAGTGATCTTGGTTGGAATGCTTGGTGCTAACCCAATTCCTAAACAATTTCAAAACGGTGGCTC
CTATGCTCAGTTTTCAATTGCCACTTCAGAAAAATACCAGGACAAACGCACTGGAGATTGGATTGAAAATACTGAGTGGC
ATCGGATTGTGGCTCACAACCGCCTAGGTGAAATTGCCTGTCAATTTCTCAAAAAAGGTTCAAAAGTTTATATCGAAGGC
TCATTACATACCCGGAAATGGACTGACCAAAATAATCAAGAACGTTACGTAACTGAAGTTAGAGCCATTACATTTCAATC
GCTCGATAGCTTGCCACAAGCAAACCCGGTTTAA
ATGCGCGGAATAAATAAAGTGATCTTGGTTGGAATGCTTGGTGCTAACCCAATTCCTAAACAATTTCAAAACGGTGGCTC
CTATGCTCAGTTTTCAATTGCCACTTCAGAAAAATACCAGGACAAACGCACTGGAGATTGGATTGAAAATACTGAGTGGC
ATCGGATTGTGGCTCACAACCGCCTAGGTGAAATTGCCTGTCAATTTCTCAAAAAAGGTTCAAAAGTTTATATCGAAGGC
TCATTACATACCCGGAAATGGACTGACCAAAATAATCAAGAACGTTACGTAACTGAAGTTAGAGCCATTACATTTCAATC
GCTCGATAGCTTGCCACAAGCAAACCCGGTTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Glaesserella parasuis strain SC1401 |
55.455 |
94.017 |
0.521 |
| ssb | Vibrio cholerae strain A1552 |
54.545 |
84.615 |
0.462 |
| ssb | Neisseria gonorrhoeae MS11 |
42.857 |
89.744 |
0.385 |
| ssb | Neisseria meningitidis MC58 |
42.857 |
89.744 |
0.385 |