Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | OS080_RS01930 | Genome accession | NZ_CP113032 |
| Coordinates | 373350..373853 (+) | Length | 167 a.a. |
| NCBI ID | WP_000934798.1 | Uniprot ID | A0A0Z0SL74 |
| Organism | Staphylococcus aureus strain Akali | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 357045..448011 | 373350..373853 | within | 0 |
Gene organization within MGE regions
Location: 357045..448011
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OS080_RS01860 | - | 357601..358230 (+) | 630 | WP_000677714.1 | ABC-2 transporter permease | - |
| OS080_RS01865 | - | 358597..359730 (-) | 1134 | WP_000245685.1 | low temperature requirement protein A | - |
| OS080_RS01870 | - | 360269..361450 (+) | 1182 | WP_000199070.1 | acetyl-CoA C-acetyltransferase | - |
| OS080_RS01875 | - | 361533..362285 (-) | 753 | WP_000195907.1 | cyclase family protein | - |
| OS080_RS01880 | metE | 362328..364556 (-) | 2229 | WP_000207614.1 | 5-methyltetrahydropteroyltriglutamate-- homocysteine S-methyltransferase | - |
| OS080_RS01885 | - | 364553..366394 (-) | 1842 | WP_000077318.1 | bifunctional homocysteine S-methyltransferase/methylenetetrahydrofolate reductase | - |
| OS080_RS01890 | metC | 366363..367523 (-) | 1161 | WP_000175846.1 | cystathionine beta-lyase MetC | - |
| OS080_RS01895 | - | 367520..368623 (-) | 1104 | WP_000655692.1 | PLP-dependent transferase | - |
| OS080_RS01900 | - | 369287..370132 (+) | 846 | WP_001550052.1 | ParB/RepB/Spo0J family partition protein | - |
| OS080_RS01905 | - | 370289..371170 (+) | 882 | WP_001077602.1 | mechanosensitive ion channel family protein | - |
| OS080_RS01910 | - | 371200..371403 (+) | 204 | WP_000157345.1 | DUF951 domain-containing protein | - |
| OS080_RS01915 | ychF | 371415..372512 (+) | 1098 | WP_001218732.1 | redox-regulated ATPase YchF | - |
| OS080_RS01920 | - | 372598..372789 (-) | 192 | WP_001052483.1 | hypothetical protein | - |
| OS080_RS01925 | rpsF | 373033..373329 (+) | 297 | WP_267790183.1 | 30S ribosomal protein S6 | - |
| OS080_RS01930 | ssbA | 373350..373853 (+) | 504 | WP_000934798.1 | single-stranded DNA-binding protein | Machinery gene |
| OS080_RS01935 | rpsR | 373905..374147 (+) | 243 | WP_000897044.1 | 30S ribosomal protein S18 | - |
| OS080_RS01940 | - | 374413..375351 (-) | 939 | WP_001822249.1 | Abi family protein | - |
| OS080_RS01945 | - | 375390..376091 (-) | 702 | Protein_361 | tyrosine-type recombinase/integrase | - |
| OS080_RS01950 | selX | 376297..376908 (+) | 612 | WP_000475326.1 | staphylococcal enterotoxin-like toxin X | - |
| OS080_RS01955 | - | 377277..377645 (+) | 369 | WP_000849177.1 | YxeA family protein | - |
| OS080_RS01960 | - | 377826..378398 (+) | 573 | WP_000769720.1 | PepSY domain-containing protein | - |
| OS080_RS01965 | - | 378536..378799 (-) | 264 | WP_001055897.1 | helix-turn-helix domain-containing protein | - |
| OS080_RS01970 | - | 379099..379350 (+) | 252 | WP_000466748.1 | GlsB/YeaQ/YmgE family stress response membrane protein | - |
| OS080_RS01975 | - | 379389..379598 (-) | 210 | WP_000211676.1 | hypothetical protein | - |
| OS080_RS01980 | - | 379776..380357 (+) | 582 | WP_000158374.1 | histidine phosphatase family protein | - |
| OS080_RS01985 | - | 380423..380806 (-) | 384 | WP_000868248.1 | hypothetical protein | - |
| OS080_RS01990 | - | 381061..381687 (-) | 627 | WP_000746687.1 | NDxxF motif lipoprotein | - |
| OS080_RS01995 | - | 381760..381996 (-) | 237 | Protein_371 | hypothetical protein | - |
| OS080_RS02000 | ahpF | 382132..383655 (-) | 1524 | WP_000930486.1 | alkyl hydroperoxide reductase subunit F | - |
| OS080_RS02005 | ahpC | 383671..384240 (-) | 570 | WP_000052781.1 | alkyl hydroperoxide reductase subunit C | - |
| OS080_RS02010 | nfsA | 384732..385487 (+) | 756 | WP_001289311.1 | oxygen-insensitive NADPH nitroreductase | - |
| OS080_RS02015 | - | 385568..386956 (-) | 1389 | WP_000991007.1 | L-cystine transporter | - |
| OS080_RS02020 | - | 387041..387142 (+) | 102 | WP_001789518.1 | hypothetical protein | - |
| OS080_RS02025 | - | 387933..388889 (-) | 957 | WP_000956132.1 | hypothetical protein | - |
| OS080_RS02030 | - | 389007..389669 (-) | 663 | WP_000394699.1 | hypothetical protein | - |
| OS080_RS02035 | - | 389812..390219 (-) | 408 | WP_000763768.1 | general stress protein | - |
| OS080_RS02040 | xpt | 390732..391310 (+) | 579 | WP_000421410.1 | xanthine phosphoribosyltransferase | - |
| OS080_RS02045 | pbuX | 391310..392568 (+) | 1259 | Protein_381 | xanthine permease PbuX | - |
| OS080_RS02050 | guaB | 392606..394072 (+) | 1467 | WP_000264071.1 | IMP dehydrogenase | - |
| OS080_RS02055 | guaA | 394097..395638 (+) | 1542 | WP_000424966.1 | glutamine-hydrolyzing GMP synthase | - |
| OS080_RS02060 | - | 395706..396899 (-) | 1194 | WP_000237797.1 | site-specific integrase | - |
| OS080_RS02065 | - | 396926..397126 (-) | 201 | WP_000633907.1 | DUF3173 family protein | - |
| OS080_RS02070 | - | 397624..397854 (-) | 231 | WP_000845143.1 | helix-turn-helix domain-containing protein | - |
| OS080_RS02075 | - | 397851..398273 (-) | 423 | WP_267793689.1 | RNA polymerase sigma factor | - |
| OS080_RS02080 | - | 398804..399157 (+) | 354 | WP_001227350.1 | helix-turn-helix domain-containing protein | - |
| OS080_RS02085 | - | 399215..399400 (-) | 186 | WP_413926387.1 | cysteine-rich KTR domain-containing protein | - |
| OS080_RS02090 | tet(M) | 399501..401420 (-) | 1920 | WP_000691737.1 | tetracycline resistance ribosomal protection protein Tet(M) | - |
| OS080_RS15895 | - | 401436..401483 (-) | 48 | Protein_391 | hypothetical protein | - |
| OS080_RS02100 | - | 401797..402726 (-) | 930 | WP_000584387.1 | conjugal transfer protein | - |
| OS080_RS02105 | - | 402743..403765 (-) | 1023 | WP_000768373.1 | bifunctional lytic transglycosylase/C40 family peptidase | - |
| OS080_RS02110 | - | 403762..405789 (-) | 2028 | WP_000192392.1 | CD3337/EF1877 family mobilome membrane protein | - |
| OS080_RS02115 | - | 405786..408230 (-) | 2445 | WP_000331167.1 | ATP-binding protein | - |
| OS080_RS02120 | - | 408214..408609 (-) | 396 | WP_000723887.1 | conjugal transfer protein | - |
| OS080_RS02125 | - | 408896..409132 (+) | 237 | WP_001159903.1 | hypothetical protein | - |
| OS080_RS02130 | - | 409139..411091 (+) | 1953 | WP_000163792.1 | hypothetical protein | - |
| OS080_RS02135 | dfrG | 411163..411660 (-) | 498 | WP_000868795.1 | trimethoprim-resistant dihydrofolate reductase DfrG | - |
| OS080_RS02140 | - | 411966..412595 (-) | 630 | WP_000273483.1 | DUF6037 family protein | - |
| OS080_RS02145 | istB | 412624..413352 (-) | 729 | WP_001071399.1 | IS21-like element helper ATPase IstB | - |
| OS080_RS02150 | istA | 413352..414779 (-) | 1428 | WP_000957075.1 | IS21 family transposase | - |
| OS080_RS02155 | - | 414863..414991 (-) | 129 | WP_000248478.1 | hypothetical protein | - |
| OS080_RS02160 | - | 415047..415547 (-) | 501 | WP_000425404.1 | antirestriction protein ArdA | - |
| OS080_RS02165 | - | 415608..416387 (-) | 780 | WP_000675717.1 | abortive infection family protein | - |
| OS080_RS02170 | - | 416429..416650 (-) | 222 | WP_001009054.1 | hypothetical protein | - |
| OS080_RS02175 | - | 416647..416937 (-) | 291 | WP_000055376.1 | hypothetical protein | - |
| OS080_RS02180 | mobT | 416934..418118 (-) | 1185 | WP_000426689.1 | MobT family relaxase | - |
| OS080_RS02185 | - | 418300..419703 (-) | 1404 | WP_001130245.1 | FtsK/SpoIIIE domain-containing protein | - |
| OS080_RS02190 | - | 419725..420498 (-) | 774 | WP_000185761.1 | hypothetical protein | - |
| OS080_RS02195 | - | 420508..420885 (-) | 378 | WP_001234191.1 | YdcP family protein | - |
| OS080_RS02200 | - | 420906..421220 (-) | 315 | WP_000421279.1 | YdcP family protein | - |
| OS080_RS02205 | - | 421420..423213 (-) | 1794 | Protein_413 | UvrD-helicase domain-containing protein | - |
| OS080_RS02210 | - | 423210..425399 (-) | 2190 | WP_000470931.1 | ATP-dependent nuclease | - |
| OS080_RS02215 | - | 425533..426730 (-) | 1198 | Protein_415 | IS256-like element ISLgar5 family transposase | - |
| OS080_RS02220 | - | 427224..427760 (-) | 537 | WP_000551776.1 | hypothetical protein | - |
| OS080_RS02225 | - | 428153..428857 (-) | 705 | WP_000041883.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| OS080_RS02230 | - | 429256..429528 (-) | 273 | WP_000159787.1 | transposase | - |
| OS080_RS02235 | - | 429789..429941 (-) | 153 | WP_000248839.1 | hypothetical protein | - |
| OS080_RS02240 | - | 430465..430824 (-) | 360 | WP_001021622.1 | DUF1304 domain-containing protein | - |
| OS080_RS02245 | - | 430843..431688 (-) | 846 | WP_001024377.1 | SDR family oxidoreductase | - |
| OS080_RS02250 | - | 432160..432840 (+) | 681 | WP_000669005.1 | superantigen-like protein SSL1 | - |
| OS080_RS02255 | - | 433126..433821 (+) | 696 | WP_000782618.1 | superantigen-like protein SSL2 | - |
| OS080_RS02260 | - | 434112..435170 (+) | 1059 | WP_000784024.1 | superantigen-like protein SSL3 | - |
| OS080_RS02265 | - | 435289..435426 (+) | 138 | WP_001791691.1 | hypothetical protein | - |
| OS080_RS02270 | - | 435535..436461 (+) | 927 | WP_000705644.1 | superantigen-like protein SSL4 | - |
| OS080_RS02275 | - | 436825..437529 (+) | 705 | WP_000784244.1 | superantigen-like protein SSL5 | - |
| OS080_RS02280 | - | 437975..438670 (+) | 696 | WP_000769845.1 | superantigen-like protein SSL6 | - |
| OS080_RS02285 | - | 439091..439786 (+) | 696 | WP_000769836.1 | superantigen-like protein SSL7 | - |
| OS080_RS02290 | - | 440129..440827 (+) | 699 | WP_000673479.1 | superantigen-like protein SSL8 | - |
| OS080_RS02295 | - | 441207..441905 (+) | 699 | WP_000779446.1 | superantigen-like protein SSL9 | - |
| OS080_RS02300 | - | 442271..442954 (+) | 684 | WP_000673051.1 | superantigen-like protein SSL10 | - |
| OS080_RS02305 | - | 443039..443140 (-) | 102 | WP_010956543.1 | hypothetical protein | - |
| OS080_RS02310 | - | 443218..444774 (+) | 1557 | WP_000028628.1 | type I restriction-modification system subunit M | - |
| OS080_RS02315 | - | 444767..445978 (+) | 1212 | WP_000072584.1 | restriction endonuclease subunit S | - |
| OS080_RS02320 | - | 446361..447038 (+) | 678 | WP_000769163.1 | superantigen-like protein SSL11 | - |
Sequence
Protein
Download Length: 167 a.a. Molecular weight: 18571.18 Da Isoelectric Point: 4.7305
>NTDB_id=759268 OS080_RS01930 WP_000934798.1 373350..373853(+) (ssbA) [Staphylococcus aureus strain Akali]
MLNRVVLVGRLTKDPEYRTTPSGVSVATFTLAVNRTFTNAQGEREADFINCVVFRRQADNVNNYLSKGSLAGVDGRLQSR
NYENQEGRRVFVTEVMCDSVQFLEPKNAQQNGGQRQQNEFQDYGQGFGGQQSGQNNSYNNSSNTKQSDNPFANANGPIDI
SDDDLPF
MLNRVVLVGRLTKDPEYRTTPSGVSVATFTLAVNRTFTNAQGEREADFINCVVFRRQADNVNNYLSKGSLAGVDGRLQSR
NYENQEGRRVFVTEVMCDSVQFLEPKNAQQNGGQRQQNEFQDYGQGFGGQQSGQNNSYNNSSNTKQSDNPFANANGPIDI
SDDDLPF
Nucleotide
Download Length: 504 bp
>NTDB_id=759268 OS080_RS01930 WP_000934798.1 373350..373853(+) (ssbA) [Staphylococcus aureus strain Akali]
ATGCTAAATAGAGTTGTATTAGTAGGTCGTTTAACGAAAGATCCGGAATACAGAACCACTCCCTCAGGTGTGAGTGTAGC
GACATTCACTCTTGCAGTAAATCGTACGTTCACGAATGCTCAAGGGGAGCGCGAAGCAGATTTTATTAACTGTGTTGTTT
TTAGAAGACAAGCAGATAATGTAAATAACTATTTATCTAAAGGTAGTTTAGCTGGTGTAGATGGTCGCTTACAATCCCGT
AATTATGAAAATCAAGAAGGTCGTCGTGTGTTTGTTACTGAAGTTATGTGTGATAGCGTTCAATTCCTTGAACCTAAAAA
TGCGCAACAAAATGGTGGCCAACGTCAACAAAATGAATTCCAAGATTACGGTCAAGGATTCGGTGGTCAACAATCAGGAC
AAAACAATTCGTACAATAATTCATCAAACACGAAACAATCTGATAATCCATTTGCAAATGCAAACGGACCGATTGATATA
AGTGATGATGACTTACCATTCTAA
ATGCTAAATAGAGTTGTATTAGTAGGTCGTTTAACGAAAGATCCGGAATACAGAACCACTCCCTCAGGTGTGAGTGTAGC
GACATTCACTCTTGCAGTAAATCGTACGTTCACGAATGCTCAAGGGGAGCGCGAAGCAGATTTTATTAACTGTGTTGTTT
TTAGAAGACAAGCAGATAATGTAAATAACTATTTATCTAAAGGTAGTTTAGCTGGTGTAGATGGTCGCTTACAATCCCGT
AATTATGAAAATCAAGAAGGTCGTCGTGTGTTTGTTACTGAAGTTATGTGTGATAGCGTTCAATTCCTTGAACCTAAAAA
TGCGCAACAAAATGGTGGCCAACGTCAACAAAATGAATTCCAAGATTACGGTCAAGGATTCGGTGGTCAACAATCAGGAC
AAAACAATTCGTACAATAATTCATCAAACACGAAACAATCTGATAATCCATTTGCAAATGCAAACGGACCGATTGATATA
AGTGATGATGACTTACCATTCTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
65.341 |
100 |
0.689 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
54.386 |
100 |
0.557 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
58.491 |
63.473 |
0.371 |
| ssb | Glaesserella parasuis strain SC1401 |
34.463 |
100 |
0.365 |