Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | OS080_RS01475 | Genome accession | NZ_CP113032 |
| Coordinates | 295994..296464 (+) | Length | 156 a.a. |
| NCBI ID | WP_000934759.1 | Uniprot ID | A0A2I7Y8V1 |
| Organism | Staphylococcus aureus strain Akali | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 285409..327905 | 295994..296464 | within | 0 |
Gene organization within MGE regions
Location: 285409..327905
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OS080_RS01390 | - | 285409..286614 (-) | 1206 | WP_000264186.1 | tyrosine-type recombinase/integrase | - |
| OS080_RS01395 | - | 286725..286904 (+) | 180 | WP_000337826.1 | hypothetical protein | - |
| OS080_RS01400 | - | 286884..287816 (-) | 933 | WP_000392181.1 | hypothetical protein | - |
| OS080_RS01405 | - | 287848..288573 (-) | 726 | WP_000661437.1 | PH domain-containing protein | - |
| OS080_RS01410 | - | 288601..289275 (-) | 675 | WP_000775187.1 | ImmA/IrrE family metallo-endopeptidase | - |
| OS080_RS01415 | - | 289292..289624 (-) | 333 | WP_001055143.1 | helix-turn-helix domain-containing protein | - |
| OS080_RS01420 | - | 289887..290081 (+) | 195 | WP_000108122.1 | helix-turn-helix domain-containing protein | - |
| OS080_RS01425 | - | 290081..290848 (+) | 768 | WP_001002757.1 | phage antirepressor Ant | - |
| OS080_RS01430 | tscA | 290849..291073 (+) | 225 | WP_000187184.1 | type II toxin-antitoxin system antitoxin TscA | - |
| OS080_RS01435 | - | 291113..291212 (+) | 100 | Protein_258 | hypothetical protein | - |
| OS080_RS01440 | - | 291361..291624 (+) | 264 | WP_001124198.1 | helix-turn-helix domain-containing protein | - |
| OS080_RS01445 | - | 291636..291797 (+) | 162 | WP_000066021.1 | DUF1270 family protein | - |
| OS080_RS01450 | - | 291889..292149 (+) | 261 | WP_000291089.1 | DUF1108 family protein | - |
| OS080_RS01455 | - | 292158..292421 (+) | 264 | WP_001205732.1 | hypothetical protein | - |
| OS080_RS01460 | - | 292430..294373 (+) | 1944 | WP_000700555.1 | AAA family ATPase | - |
| OS080_RS01465 | - | 294375..295295 (+) | 921 | WP_000180598.1 | recombinase RecT | - |
| OS080_RS01470 | - | 295376..295993 (+) | 618 | WP_064135358.1 | MBL fold metallo-hydrolase | - |
| OS080_RS01475 | ssbA | 295994..296464 (+) | 471 | WP_000934759.1 | single-stranded DNA-binding protein | Machinery gene |
| OS080_RS01480 | - | 296494..297387 (+) | 894 | WP_000148333.1 | DnaD domain protein | - |
| OS080_RS01485 | - | 297394..297612 (+) | 219 | WP_000338528.1 | hypothetical protein | - |
| OS080_RS01490 | - | 297621..298025 (+) | 405 | WP_000401969.1 | RusA family crossover junction endodeoxyribonuclease | - |
| OS080_RS01495 | - | 298038..298410 (+) | 373 | Protein_270 | SA1788 family PVL leukocidin-associated protein | - |
| OS080_RS01500 | - | 298410..298667 (+) | 258 | WP_000111491.1 | DUF3310 domain-containing protein | - |
| OS080_RS01505 | - | 298670..298912 (+) | 243 | WP_000221871.1 | SAV1978 family virulence-associated passenger protein | - |
| OS080_RS01510 | - | 298925..299326 (+) | 402 | WP_000695762.1 | hypothetical protein | - |
| OS080_RS01515 | - | 299323..299670 (+) | 348 | WP_072482945.1 | YopX family protein | - |
| OS080_RS01520 | - | 299667..299975 (+) | 309 | WP_000144710.1 | hypothetical protein | - |
| OS080_RS01525 | - | 299968..300216 (+) | 249 | WP_001065026.1 | DUF1024 family protein | - |
| OS080_RS01530 | - | 300209..300745 (+) | 537 | WP_000185663.1 | dUTPase | - |
| OS080_RS01535 | - | 300782..300982 (+) | 201 | WP_000195821.1 | DUF1381 domain-containing protein | - |
| OS080_RS01540 | - | 301081..301317 (+) | 237 | WP_000608279.1 | DUF7366 family protein | - |
| OS080_RS01545 | rinB | 301310..301483 (+) | 174 | WP_000591891.1 | transcriptional activator RinB | - |
| OS080_RS01550 | - | 301484..301849 (+) | 366 | WP_000989954.1 | hypothetical protein | - |
| OS080_RS01555 | - | 301850..301996 (+) | 147 | WP_000989960.1 | hypothetical protein | - |
| OS080_RS01560 | - | 302020..302460 (+) | 441 | WP_000162703.1 | RinA family phage transcriptional activator | - |
| OS080_RS01565 | - | 302771..303265 (+) | 495 | WP_000594082.1 | terminase small subunit | - |
| OS080_RS01570 | - | 303258..304466 (+) | 1209 | WP_001606760.1 | PBSX family phage terminase large subunit | - |
| OS080_RS01575 | - | 304480..305898 (+) | 1419 | WP_000283553.1 | phage portal protein | - |
| OS080_RS01580 | - | 305837..306820 (+) | 984 | WP_267790143.1 | phage head morphogenesis protein | - |
| OS080_RS01585 | - | 306822..307028 (+) | 207 | WP_000346033.1 | hypothetical protein | - |
| OS080_RS01590 | - | 307133..307729 (+) | 597 | WP_000366932.1 | phage scaffolding protein | - |
| OS080_RS01595 | - | 307750..308574 (+) | 825 | WP_001135558.1 | N4-gp56 family major capsid protein | - |
| OS080_RS01600 | - | 308591..308917 (+) | 327 | WP_000278799.1 | Rho termination factor N-terminal domain-containing protein | - |
| OS080_RS01605 | - | 308917..309231 (+) | 315 | WP_000338935.1 | phage head-tail connector protein | - |
| OS080_RS01610 | - | 309224..309559 (+) | 336 | WP_017431444.1 | phage head closure protein | - |
| OS080_RS01615 | - | 309546..309959 (+) | 414 | WP_001151335.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| OS080_RS01620 | - | 309972..310409 (+) | 438 | WP_000270196.1 | DUF3168 domain-containing protein | - |
| OS080_RS01625 | - | 310396..310956 (+) | 561 | WP_000046067.1 | hypothetical protein | - |
| OS080_RS01630 | - | 311018..311512 (+) | 495 | WP_000141082.1 | tail assembly chaperone | - |
| OS080_RS01635 | - | 311533..311874 (+) | 342 | WP_001580347.1 | hypothetical protein | - |
| OS080_RS01640 | - | 311877..314846 (+) | 2970 | WP_000414234.1 | phage tail protein | - |
| OS080_RS01645 | - | 314861..315796 (+) | 936 | WP_000560193.1 | phage tail domain-containing protein | - |
| OS080_RS01650 | - | 315807..317690 (+) | 1884 | WP_001144702.1 | SGNH/GDSL hydrolase family protein | - |
| OS080_RS01655 | - | 317703..319601 (+) | 1899 | WP_000323252.1 | hypothetical protein | - |
| OS080_RS01660 | - | 319601..321424 (+) | 1824 | WP_000259636.1 | phage baseplate upper protein | - |
| OS080_RS01665 | - | 321424..321801 (+) | 378 | WP_000869363.1 | DUF2977 domain-containing protein | - |
| OS080_RS01670 | - | 321811..321984 (+) | 174 | WP_015990323.1 | XkdX family protein | - |
| OS080_RS01675 | - | 322025..322324 (+) | 300 | WP_000466769.1 | DUF2951 domain-containing protein | - |
| OS080_RS01680 | - | 322461..324335 (+) | 1875 | WP_000524040.1 | glucosaminidase domain-containing protein | - |
| OS080_RS01685 | - | 324348..325586 (+) | 1239 | WP_000276640.1 | BppU family phage baseplate upper protein | - |
| OS080_RS01690 | - | 325591..325986 (+) | 396 | WP_000387945.1 | hypothetical protein | - |
| OS080_RS01695 | - | 326042..326479 (+) | 438 | WP_000354132.1 | phage holin | - |
| OS080_RS01700 | - | 326460..327905 (+) | 1446 | WP_001148131.1 | SH3 domain-containing protein | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17641.52 Da Isoelectric Point: 5.2672
>NTDB_id=759267 OS080_RS01475 WP_000934759.1 295994..296464(+) (ssbA) [Staphylococcus aureus strain Akali]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDNDLPF
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDNDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=759267 OS080_RS01475 WP_000934759.1 295994..296464(+) (ssbA) [Staphylococcus aureus strain Akali]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.932 |
100 |
0.635 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50.588 |
100 |
0.551 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Glaesserella parasuis strain SC1401 |
32.203 |
100 |
0.365 |