Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | OS078_RS05030 | Genome accession | NZ_CP113015 |
| Coordinates | 1003625..1004095 (+) | Length | 156 a.a. |
| NCBI ID | WP_000934759.1 | Uniprot ID | A0A2I7Y8V1 |
| Organism | Staphylococcus aureus strain Zed | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 983800..1035536 | 1003625..1004095 | within | 0 |
Gene organization within MGE regions
Location: 983800..1035536
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OS078_RS04910 | - | 983800..985332 (-) | 1533 | WP_000665741.1 | sodium:solute symporter | - |
| OS078_RS04915 | - | 985372..986253 (-) | 882 | WP_001030738.1 | N-acetylneuraminate lyase | - |
| OS078_RS04920 | - | 986411..987271 (+) | 861 | WP_000291432.1 | ROK family protein | - |
| OS078_RS04925 | - | 987548..988348 (-) | 801 | WP_000667382.1 | MurR/RpiR family transcriptional regulator | - |
| OS078_RS04930 | - | 988488..989156 (+) | 669 | WP_000936720.1 | N-acetylmannosamine-6-phosphate 2-epimerase | - |
| OS078_RS04935 | - | 989282..990595 (-) | 1314 | WP_001077711.1 | YjiH family protein | - |
| OS078_RS04940 | lip2 | 991012..992946 (+) | 1935 | Protein_946 | YSIRK domain-containing triacylglycerol lipase Lip2/Geh | - |
| OS078_RS04945 | - | 993040..994245 (-) | 1206 | WP_000264186.1 | tyrosine-type recombinase/integrase | - |
| OS078_RS04950 | - | 994356..994535 (+) | 180 | WP_000337826.1 | hypothetical protein | - |
| OS078_RS04955 | - | 994515..995447 (-) | 933 | WP_000392181.1 | hypothetical protein | - |
| OS078_RS04960 | - | 995479..996204 (-) | 726 | WP_000661437.1 | PH domain-containing protein | - |
| OS078_RS04965 | - | 996232..996906 (-) | 675 | WP_000775187.1 | ImmA/IrrE family metallo-endopeptidase | - |
| OS078_RS04970 | - | 996923..997255 (-) | 333 | WP_001055143.1 | helix-turn-helix domain-containing protein | - |
| OS078_RS04975 | - | 997518..997712 (+) | 195 | WP_000108122.1 | helix-turn-helix domain-containing protein | - |
| OS078_RS04980 | - | 997712..998479 (+) | 768 | WP_001002757.1 | phage antirepressor Ant | - |
| OS078_RS04985 | tscA | 998480..998704 (+) | 225 | WP_000187184.1 | type II toxin-antitoxin system antitoxin TscA | - |
| OS078_RS04990 | - | 998744..998843 (+) | 100 | Protein_956 | hypothetical protein | - |
| OS078_RS04995 | - | 998992..999255 (+) | 264 | WP_001124198.1 | helix-turn-helix domain-containing protein | - |
| OS078_RS05000 | - | 999267..999428 (+) | 162 | WP_000066021.1 | DUF1270 family protein | - |
| OS078_RS05005 | - | 999520..999780 (+) | 261 | WP_000291089.1 | DUF1108 family protein | - |
| OS078_RS05010 | - | 999789..1000052 (+) | 264 | WP_001205732.1 | hypothetical protein | - |
| OS078_RS05015 | - | 1000061..1002004 (+) | 1944 | WP_000700555.1 | AAA family ATPase | - |
| OS078_RS05020 | - | 1002006..1002926 (+) | 921 | WP_000180598.1 | recombinase RecT | - |
| OS078_RS05025 | - | 1003007..1003624 (+) | 618 | WP_064135358.1 | MBL fold metallo-hydrolase | - |
| OS078_RS05030 | ssbA | 1003625..1004095 (+) | 471 | WP_000934759.1 | single-stranded DNA-binding protein | Machinery gene |
| OS078_RS05035 | - | 1004125..1005018 (+) | 894 | WP_000148333.1 | DnaD domain protein | - |
| OS078_RS05040 | - | 1005025..1005243 (+) | 219 | WP_000338528.1 | hypothetical protein | - |
| OS078_RS05045 | - | 1005252..1005656 (+) | 405 | WP_000401969.1 | RusA family crossover junction endodeoxyribonuclease | - |
| OS078_RS05050 | - | 1005669..1006041 (+) | 373 | Protein_968 | SA1788 family PVL leukocidin-associated protein | - |
| OS078_RS05055 | - | 1006041..1006298 (+) | 258 | WP_000111491.1 | DUF3310 domain-containing protein | - |
| OS078_RS05060 | - | 1006301..1006543 (+) | 243 | WP_000221871.1 | SAV1978 family virulence-associated passenger protein | - |
| OS078_RS05065 | - | 1006556..1006957 (+) | 402 | WP_000695762.1 | hypothetical protein | - |
| OS078_RS05070 | - | 1006954..1007301 (+) | 348 | WP_072482945.1 | YopX family protein | - |
| OS078_RS05075 | - | 1007298..1007606 (+) | 309 | WP_000144710.1 | hypothetical protein | - |
| OS078_RS05080 | - | 1007599..1007847 (+) | 249 | WP_001065026.1 | DUF1024 family protein | - |
| OS078_RS05085 | - | 1007840..1008376 (+) | 537 | WP_000185663.1 | dUTPase | - |
| OS078_RS05090 | - | 1008413..1008613 (+) | 201 | WP_000195821.1 | DUF1381 domain-containing protein | - |
| OS078_RS05095 | - | 1008712..1008948 (+) | 237 | WP_000608279.1 | DUF7366 family protein | - |
| OS078_RS05100 | rinB | 1008941..1009114 (+) | 174 | WP_000591891.1 | transcriptional activator RinB | - |
| OS078_RS05105 | - | 1009115..1009480 (+) | 366 | WP_000989954.1 | hypothetical protein | - |
| OS078_RS05110 | - | 1009481..1009627 (+) | 147 | WP_000989960.1 | hypothetical protein | - |
| OS078_RS05115 | - | 1009651..1010091 (+) | 441 | WP_000162703.1 | RinA family phage transcriptional activator | - |
| OS078_RS05120 | - | 1010402..1010896 (+) | 495 | WP_000594082.1 | terminase small subunit | - |
| OS078_RS05125 | - | 1010889..1012097 (+) | 1209 | WP_001606760.1 | PBSX family phage terminase large subunit | - |
| OS078_RS05130 | - | 1012051..1013529 (+) | 1479 | WP_001159668.1 | phage portal protein | - |
| OS078_RS05135 | - | 1013468..1014451 (+) | 984 | WP_267790143.1 | phage head morphogenesis protein | - |
| OS078_RS05140 | - | 1014453..1014659 (+) | 207 | WP_000346033.1 | hypothetical protein | - |
| OS078_RS05145 | - | 1014764..1015360 (+) | 597 | WP_000366932.1 | phage scaffolding protein | - |
| OS078_RS05150 | - | 1015381..1016205 (+) | 825 | WP_001135558.1 | N4-gp56 family major capsid protein | - |
| OS078_RS05155 | - | 1016222..1016548 (+) | 327 | WP_000278799.1 | Rho termination factor N-terminal domain-containing protein | - |
| OS078_RS05160 | - | 1016548..1016862 (+) | 315 | WP_000338935.1 | phage head-tail connector protein | - |
| OS078_RS05165 | - | 1016855..1017190 (+) | 336 | WP_017431444.1 | phage head closure protein | - |
| OS078_RS05170 | - | 1017177..1017590 (+) | 414 | WP_001151335.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| OS078_RS05175 | - | 1017603..1018040 (+) | 438 | WP_000270196.1 | DUF3168 domain-containing protein | - |
| OS078_RS05180 | - | 1018027..1018587 (+) | 561 | WP_000046067.1 | hypothetical protein | - |
| OS078_RS05185 | - | 1018649..1019143 (+) | 495 | WP_000141082.1 | tail assembly chaperone | - |
| OS078_RS05190 | - | 1019164..1019505 (+) | 342 | WP_001580347.1 | hypothetical protein | - |
| OS078_RS05195 | - | 1019508..1022477 (+) | 2970 | WP_000414234.1 | phage tail protein | - |
| OS078_RS05200 | - | 1022492..1023427 (+) | 936 | WP_000560193.1 | phage tail domain-containing protein | - |
| OS078_RS05205 | - | 1023438..1025321 (+) | 1884 | WP_001144702.1 | SGNH/GDSL hydrolase family protein | - |
| OS078_RS05210 | - | 1025334..1027232 (+) | 1899 | WP_000323252.1 | hypothetical protein | - |
| OS078_RS05215 | - | 1027232..1029055 (+) | 1824 | WP_000259636.1 | phage baseplate upper protein | - |
| OS078_RS05220 | - | 1029055..1029432 (+) | 378 | WP_000869363.1 | DUF2977 domain-containing protein | - |
| OS078_RS05225 | - | 1029442..1029615 (+) | 174 | WP_015990323.1 | XkdX family protein | - |
| OS078_RS05230 | - | 1029656..1029955 (+) | 300 | WP_000466769.1 | DUF2951 domain-containing protein | - |
| OS078_RS05235 | - | 1030092..1031966 (+) | 1875 | WP_000524040.1 | glucosaminidase domain-containing protein | - |
| OS078_RS05240 | - | 1031979..1033217 (+) | 1239 | WP_000276640.1 | BppU family phage baseplate upper protein | - |
| OS078_RS05245 | - | 1033222..1033617 (+) | 396 | WP_000387945.1 | hypothetical protein | - |
| OS078_RS05250 | - | 1033673..1034110 (+) | 438 | WP_000354132.1 | phage holin | - |
| OS078_RS05255 | - | 1034091..1035536 (+) | 1446 | WP_001148131.1 | SH3 domain-containing protein | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17641.52 Da Isoelectric Point: 5.2672
>NTDB_id=759051 OS078_RS05030 WP_000934759.1 1003625..1004095(+) (ssbA) [Staphylococcus aureus strain Zed]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDNDLPF
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDNDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=759051 OS078_RS05030 WP_000934759.1 1003625..1004095(+) (ssbA) [Staphylococcus aureus strain Zed]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.932 |
100 |
0.635 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50.588 |
100 |
0.551 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Glaesserella parasuis strain SC1401 |
32.203 |
100 |
0.365 |