Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | OS092_RS00030 | Genome accession | NZ_CP113009 |
| Coordinates | 3870..4340 (+) | Length | 156 a.a. |
| NCBI ID | WP_000934759.1 | Uniprot ID | A0A2I7Y8V1 |
| Organism | Staphylococcus aureus strain Orianna | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 34..35781 | 3870..4340 | within | 0 |
Gene organization within MGE regions
Location: 34..35781
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OS092_RS00010 | - | 34..297 (+) | 264 | WP_001205732.1 | hypothetical protein | - |
| OS092_RS00015 | - | 306..2249 (+) | 1944 | WP_000700555.1 | AAA family ATPase | - |
| OS092_RS00020 | - | 2251..3171 (+) | 921 | WP_000180598.1 | recombinase RecT | - |
| OS092_RS00025 | - | 3252..3869 (+) | 618 | WP_064135358.1 | MBL fold metallo-hydrolase | - |
| OS092_RS00030 | ssbA | 3870..4340 (+) | 471 | WP_000934759.1 | single-stranded DNA-binding protein | Machinery gene |
| OS092_RS00035 | - | 4370..5263 (+) | 894 | WP_000148333.1 | DnaD domain protein | - |
| OS092_RS00040 | - | 5270..5488 (+) | 219 | WP_000338528.1 | hypothetical protein | - |
| OS092_RS00045 | - | 5497..5901 (+) | 405 | WP_000401969.1 | RusA family crossover junction endodeoxyribonuclease | - |
| OS092_RS00050 | - | 5914..6286 (+) | 373 | Protein_9 | SA1788 family PVL leukocidin-associated protein | - |
| OS092_RS00055 | - | 6286..6543 (+) | 258 | WP_000111491.1 | DUF3310 domain-containing protein | - |
| OS092_RS00060 | - | 6546..6788 (+) | 243 | WP_000221871.1 | SAV1978 family virulence-associated passenger protein | - |
| OS092_RS00065 | - | 6801..7202 (+) | 402 | WP_000695762.1 | hypothetical protein | - |
| OS092_RS00070 | - | 7199..7546 (+) | 348 | WP_072482945.1 | YopX family protein | - |
| OS092_RS00075 | - | 7543..7851 (+) | 309 | WP_000144710.1 | hypothetical protein | - |
| OS092_RS00080 | - | 7844..8092 (+) | 249 | WP_001065026.1 | DUF1024 family protein | - |
| OS092_RS00085 | - | 8085..8621 (+) | 537 | WP_000185663.1 | dUTPase | - |
| OS092_RS00090 | - | 8658..8858 (+) | 201 | WP_000195821.1 | DUF1381 domain-containing protein | - |
| OS092_RS00095 | - | 8957..9193 (+) | 237 | WP_000608279.1 | DUF7366 family protein | - |
| OS092_RS00100 | rinB | 9186..9359 (+) | 174 | WP_000591891.1 | transcriptional activator RinB | - |
| OS092_RS00105 | - | 9360..9725 (+) | 366 | WP_000989954.1 | hypothetical protein | - |
| OS092_RS00110 | - | 9726..9872 (+) | 147 | WP_000989960.1 | hypothetical protein | - |
| OS092_RS00115 | - | 9896..10336 (+) | 441 | WP_000162703.1 | RinA family phage transcriptional activator | - |
| OS092_RS00120 | - | 10647..11141 (+) | 495 | WP_000594082.1 | terminase small subunit | - |
| OS092_RS00125 | - | 11134..12342 (+) | 1209 | WP_001606760.1 | PBSX family phage terminase large subunit | - |
| OS092_RS00130 | - | 12356..13774 (+) | 1419 | WP_000283553.1 | phage portal protein | - |
| OS092_RS00135 | - | 13713..14696 (+) | 984 | WP_267790143.1 | phage head morphogenesis protein | - |
| OS092_RS00140 | - | 14698..14904 (+) | 207 | WP_000346033.1 | hypothetical protein | - |
| OS092_RS00145 | - | 15009..15605 (+) | 597 | WP_000366932.1 | phage scaffolding protein | - |
| OS092_RS00150 | - | 15626..16450 (+) | 825 | WP_001135558.1 | N4-gp56 family major capsid protein | - |
| OS092_RS00155 | - | 16467..16793 (+) | 327 | WP_000278799.1 | Rho termination factor N-terminal domain-containing protein | - |
| OS092_RS00160 | - | 16793..17107 (+) | 315 | WP_000338935.1 | phage head-tail connector protein | - |
| OS092_RS00165 | - | 17100..17435 (+) | 336 | WP_017431444.1 | phage head closure protein | - |
| OS092_RS00170 | - | 17422..17835 (+) | 414 | WP_001151335.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| OS092_RS00175 | - | 17848..18285 (+) | 438 | WP_000270196.1 | DUF3168 domain-containing protein | - |
| OS092_RS00180 | - | 18272..18832 (+) | 561 | WP_000046067.1 | hypothetical protein | - |
| OS092_RS00185 | - | 18894..19388 (+) | 495 | WP_000141082.1 | tail assembly chaperone | - |
| OS092_RS00190 | - | 19409..19750 (+) | 342 | WP_001580347.1 | hypothetical protein | - |
| OS092_RS00195 | - | 19753..22722 (+) | 2970 | WP_000414234.1 | phage tail protein | - |
| OS092_RS00200 | - | 22737..23672 (+) | 936 | WP_000560193.1 | phage tail domain-containing protein | - |
| OS092_RS00205 | - | 23683..25566 (+) | 1884 | WP_001144702.1 | SGNH/GDSL hydrolase family protein | - |
| OS092_RS00210 | - | 25579..27477 (+) | 1899 | WP_000323252.1 | hypothetical protein | - |
| OS092_RS00215 | - | 27477..29300 (+) | 1824 | WP_000259636.1 | phage baseplate upper protein | - |
| OS092_RS00220 | - | 29300..29677 (+) | 378 | WP_000869363.1 | DUF2977 domain-containing protein | - |
| OS092_RS00225 | - | 29687..29860 (+) | 174 | WP_015990323.1 | XkdX family protein | - |
| OS092_RS00230 | - | 29901..30200 (+) | 300 | WP_000466769.1 | DUF2951 domain-containing protein | - |
| OS092_RS00235 | - | 30337..32211 (+) | 1875 | WP_000524040.1 | glucosaminidase domain-containing protein | - |
| OS092_RS00240 | - | 32224..33462 (+) | 1239 | WP_000276640.1 | BppU family phage baseplate upper protein | - |
| OS092_RS00245 | - | 33467..33862 (+) | 396 | WP_000387945.1 | hypothetical protein | - |
| OS092_RS00250 | - | 33918..34355 (+) | 438 | WP_000354132.1 | phage holin | - |
| OS092_RS00255 | - | 34336..35781 (+) | 1446 | WP_001148131.1 | SH3 domain-containing protein | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17641.52 Da Isoelectric Point: 5.2672
>NTDB_id=758999 OS092_RS00030 WP_000934759.1 3870..4340(+) (ssbA) [Staphylococcus aureus strain Orianna]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDNDLPF
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDNDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=758999 OS092_RS00030 WP_000934759.1 3870..4340(+) (ssbA) [Staphylococcus aureus strain Orianna]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.932 |
100 |
0.635 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50.588 |
100 |
0.551 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Glaesserella parasuis strain SC1401 |
32.203 |
100 |
0.365 |