Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | OR612_RS10945 | Genome accession | NZ_CP112895 |
| Coordinates | 2252512..2252961 (-) | Length | 149 a.a. |
| NCBI ID | WP_266199913.1 | Uniprot ID | - |
| Organism | Pasteurella multocida strain PF17 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2246495..2294646 | 2252512..2252961 | within | 0 |
Gene organization within MGE regions
Location: 2246495..2294646
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OR612_RS10920 (OR612_10920) | - | 2246495..2246878 (+) | 384 | WP_230493003.1 | LysR family transcriptional regulator | - |
| OR612_RS10925 (OR612_10925) | - | 2247124..2247534 (-) | 411 | WP_010907416.1 | hypothetical protein | - |
| OR612_RS10930 (OR612_10930) | - | 2247536..2249572 (-) | 2037 | WP_010907417.1 | integrase | - |
| OR612_RS10935 (OR612_10935) | - | 2249575..2251095 (-) | 1521 | WP_010907418.1 | site-specific integrase | - |
| OR612_RS10940 (OR612_10940) | - | 2251082..2252362 (-) | 1281 | WP_016533798.1 | site-specific integrase | - |
| OR612_RS10945 (OR612_10945) | ssb | 2252512..2252961 (-) | 450 | WP_266199913.1 | single-stranded DNA-binding protein | Machinery gene |
| OR612_RS10950 (OR612_10950) | - | 2252961..2253633 (-) | 673 | Protein_2112 | translocation protein TolB precursor | - |
| OR612_RS10955 (OR612_10955) | - | 2253605..2254557 (-) | 953 | Protein_2113 | recombinase RecT | - |
| OR612_RS10960 (OR612_10960) | - | 2254559..2254846 (-) | 288 | WP_014391452.1 | hypothetical protein | - |
| OR612_RS10965 (OR612_10965) | - | 2254859..2255095 (-) | 237 | WP_075271355.1 | hypothetical protein | - |
| OR612_RS10970 (OR612_10970) | - | 2255067..2255366 (-) | 300 | WP_078802174.1 | hypothetical protein | - |
| OR612_RS10975 (OR612_10975) | - | 2255514..2255744 (+) | 231 | WP_223251317.1 | hypothetical protein | - |
| OR612_RS10980 (OR612_10980) | - | 2255806..2256564 (-) | 759 | WP_323135003.1 | KilA-N domain-containing protein | - |
| OR612_RS10985 (OR612_10985) | - | 2256703..2257080 (-) | 378 | Protein_2119 | Bro-N domain-containing protein | - |
| OR612_RS10990 (OR612_10990) | - | 2257444..2257638 (+) | 195 | WP_014391459.1 | hypothetical protein | - |
| OR612_RS10995 (OR612_10995) | - | 2257619..2257789 (-) | 171 | WP_225529669.1 | hypothetical protein | - |
| OR612_RS11000 (OR612_11000) | - | 2257802..2258032 (-) | 231 | WP_078737821.1 | hypothetical protein | - |
| OR612_RS11005 (OR612_11005) | - | 2258274..2258483 (-) | 210 | WP_005756656.1 | hypothetical protein | - |
| OR612_RS11010 (OR612_11010) | - | 2258496..2258663 (+) | 168 | WP_005756653.1 | YegP family protein | - |
| OR612_RS11015 (OR612_11015) | - | 2258969..2259283 (+) | 315 | WP_078819687.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| OR612_RS11020 (OR612_11020) | - | 2259280..2259570 (+) | 291 | WP_078819686.1 | addiction module antidote protein | - |
| OR612_RS11025 (OR612_11025) | - | 2259596..2260000 (-) | 405 | WP_146024473.1 | hypothetical protein | - |
| OR612_RS11030 (OR612_11030) | - | 2260030..2261874 (-) | 1845 | WP_071523830.1 | DEAD/DEAH box helicase | - |
| OR612_RS11035 (OR612_11035) | - | 2262085..2262768 (-) | 684 | WP_099821842.1 | helix-turn-helix transcriptional regulator | - |
| OR612_RS11040 (OR612_11040) | - | 2262893..2263093 (+) | 201 | WP_099821841.1 | YdaS family helix-turn-helix protein | - |
| OR612_RS11045 (OR612_11045) | - | 2263142..2263591 (+) | 450 | WP_099821840.1 | YmfL family putative regulatory protein | - |
| OR612_RS11050 (OR612_11050) | - | 2263649..2264332 (+) | 684 | WP_014390721.1 | phage antirepressor KilAC domain-containing protein | - |
| OR612_RS11055 (OR612_11055) | - | 2264329..2264544 (+) | 216 | WP_075271368.1 | hypothetical protein | - |
| OR612_RS11060 (OR612_11060) | - | 2264541..2265377 (+) | 837 | WP_225529668.1 | helix-turn-helix domain-containing protein | - |
| OR612_RS11065 (OR612_11065) | - | 2265377..2266066 (+) | 690 | WP_225529667.1 | replication protein P | - |
| OR612_RS11070 (OR612_11070) | - | 2266070..2266606 (+) | 537 | WP_178384709.1 | phage N-6-adenine-methyltransferase | - |
| OR612_RS11075 (OR612_11075) | - | 2266596..2267054 (+) | 459 | WP_014391471.1 | recombination protein NinB | - |
| OR612_RS11080 (OR612_11080) | - | 2267128..2267343 (+) | 216 | WP_225529666.1 | hypothetical protein | - |
| OR612_RS11085 (OR612_11085) | - | 2267336..2267938 (+) | 603 | WP_170376544.1 | recombination protein NinG | - |
| OR612_RS11090 (OR612_11090) | - | 2267939..2268400 (+) | 462 | WP_225529665.1 | antiterminator Q family protein | - |
| OR612_RS11095 (OR612_11095) | - | 2268526..2269089 (-) | 564 | WP_014667793.1 | hypothetical protein | - |
| OR612_RS11100 (OR612_11100) | - | 2269207..2269464 (+) | 258 | WP_081376958.1 | HP1 family phage holin | - |
| OR612_RS11105 (OR612_11105) | - | 2269461..2269991 (+) | 531 | WP_069915984.1 | lysozyme | - |
| OR612_RS11110 (OR612_11110) | - | 2269964..2270287 (+) | 324 | WP_078801840.1 | DUF2570 family protein | - |
| OR612_RS11115 (OR612_11115) | - | 2270497..2270865 (-) | 369 | WP_014391478.1 | helix-turn-helix domain-containing protein | - |
| OR612_RS11120 (OR612_11120) | - | 2270901..2271161 (-) | 261 | WP_005720780.1 | type II toxin-antitoxin system RelE family toxin | - |
| OR612_RS11125 (OR612_11125) | - | 2271451..2271924 (+) | 474 | WP_014391479.1 | DUF1441 family protein | - |
| OR612_RS11130 (OR612_11130) | - | 2271928..2274036 (+) | 2109 | WP_014391480.1 | phage terminase large subunit family protein | - |
| OR612_RS11135 (OR612_11135) | - | 2274033..2274254 (+) | 222 | WP_014391481.1 | hypothetical protein | - |
| OR612_RS11140 (OR612_11140) | - | 2274251..2275789 (+) | 1539 | WP_266208759.1 | phage portal protein | - |
| OR612_RS11145 (OR612_11145) | - | 2275725..2277734 (+) | 2010 | WP_078819665.1 | ClpP-like prohead protease/major capsid protein fusion protein | - |
| OR612_RS11150 (OR612_11150) | - | 2277807..2278133 (+) | 327 | WP_016570083.1 | DUF2190 family protein | - |
| OR612_RS11155 (OR612_11155) | - | 2278126..2278419 (+) | 294 | WP_014391484.1 | hypothetical protein | - |
| OR612_RS11160 (OR612_11160) | - | 2278419..2278970 (+) | 552 | WP_014391485.1 | phage tail protein | - |
| OR612_RS11165 (OR612_11165) | gpU | 2278967..2279374 (+) | 408 | WP_014391486.1 | phage tail terminator protein | - |
| OR612_RS11170 (OR612_11170) | - | 2279371..2279877 (+) | 507 | WP_078819785.1 | phage tail tube protein | - |
| OR612_RS11175 (OR612_11175) | - | 2279883..2280272 (+) | 390 | WP_016533230.1 | phage minor tail protein G | - |
| OR612_RS11180 (OR612_11180) | - | 2280293..2280595 (+) | 303 | WP_225529681.1 | phage tail assembly protein T | - |
| OR612_RS11185 (OR612_11185) | - | 2280582..2282975 (+) | 2394 | WP_225529664.1 | phage tail length tape measure family protein | - |
| OR612_RS11190 (OR612_11190) | - | 2282972..2283322 (+) | 351 | WP_005719622.1 | phage tail protein | - |
| OR612_RS11195 (OR612_11195) | - | 2283394..2283960 (+) | 567 | WP_078819667.1 | hypothetical protein | - |
| OR612_RS11200 (OR612_11200) | - | 2284114..2284818 (+) | 705 | WP_080166595.1 | phage minor tail protein L | - |
| OR612_RS11205 (OR612_11205) | - | 2284823..2285563 (+) | 741 | WP_267182202.1 | C40 family peptidase | - |
| OR612_RS11210 (OR612_11210) | - | 2285506..2286126 (+) | 621 | WP_014667799.1 | tail assembly protein | - |
| OR612_RS11215 (OR612_11215) | - | 2286130..2292024 (+) | 5895 | WP_225529663.1 | phage tail protein | - |
| OR612_RS11220 (OR612_11220) | - | 2292072..2292395 (+) | 324 | WP_014667801.1 | hypothetical protein | - |
| OR612_RS11225 (OR612_11225) | - | 2292821..2293657 (+) | 837 | WP_014390712.1 | KilA-N domain-containing protein | - |
| OR612_RS11230 (OR612_11230) | - | 2293960..2294646 (+) | 687 | WP_225529662.1 | KilA-N domain-containing protein | - |
Sequence
Protein
Download Length: 149 a.a. Molecular weight: 17024.90 Da Isoelectric Point: 6.9835
>NTDB_id=758791 OR612_RS10945 WP_266199913.1 2252512..2252961(-) (ssb) [Pasteurella multocida strain PF17]
MAGVNRVIILGNLGSDPEIRTMPNGDPVAKISVATSESWIDKNTNERKTQTEWHSIVFYRRQAEICGQYLKKGSKVYVEG
KLRTRKWQDQNGQDRYTTEIQGDVLQMLDSRQDSQQQQAQAPQNNAYANAKSGKPVQKFDNFEEDDIPF
MAGVNRVIILGNLGSDPEIRTMPNGDPVAKISVATSESWIDKNTNERKTQTEWHSIVFYRRQAEICGQYLKKGSKVYVEG
KLRTRKWQDQNGQDRYTTEIQGDVLQMLDSRQDSQQQQAQAPQNNAYANAKSGKPVQKFDNFEEDDIPF
Nucleotide
Download Length: 450 bp
>NTDB_id=758791 OR612_RS10945 WP_266199913.1 2252512..2252961(-) (ssb) [Pasteurella multocida strain PF17]
ATGGCTGGGGTTAATCGTGTAATTATTTTAGGAAATTTAGGAAGCGATCCTGAAATCCGCACAATGCCAAATGGCGACCC
TGTGGCAAAAATCAGTGTGGCCACAAGTGAAAGCTGGATTGATAAAAACACAAACGAACGAAAAACACAAACTGAATGGC
ATTCTATCGTGTTCTATCGTCGCCAAGCAGAAATTTGCGGGCAGTATTTGAAGAAAGGCTCGAAAGTTTATGTGGAAGGT
AAGCTCAGAACACGCAAATGGCAAGATCAAAATGGTCAAGACCGCTACACCACAGAGATTCAAGGCGACGTATTACAAAT
GCTAGACAGTCGCCAAGATTCACAGCAACAGCAAGCACAGGCACCACAAAATAATGCTTATGCGAATGCGAAAAGTGGAA
AACCAGTGCAGAAGTTTGATAATTTTGAAGAAGACGATATACCGTTTTGA
ATGGCTGGGGTTAATCGTGTAATTATTTTAGGAAATTTAGGAAGCGATCCTGAAATCCGCACAATGCCAAATGGCGACCC
TGTGGCAAAAATCAGTGTGGCCACAAGTGAAAGCTGGATTGATAAAAACACAAACGAACGAAAAACACAAACTGAATGGC
ATTCTATCGTGTTCTATCGTCGCCAAGCAGAAATTTGCGGGCAGTATTTGAAGAAAGGCTCGAAAGTTTATGTGGAAGGT
AAGCTCAGAACACGCAAATGGCAAGATCAAAATGGTCAAGACCGCTACACCACAGAGATTCAAGGCGACGTATTACAAAT
GCTAGACAGTCGCCAAGATTCACAGCAACAGCAAGCACAGGCACCACAAAATAATGCTTATGCGAATGCGAAAAGTGGAA
AACCAGTGCAGAAGTTTGATAATTTTGAAGAAGACGATATACCGTTTTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Glaesserella parasuis strain SC1401 |
61.878 |
100 |
0.752 |
| ssb | Vibrio cholerae strain A1552 |
52.518 |
93.289 |
0.49 |
| ssb | Neisseria meningitidis MC58 |
39.548 |
100 |
0.47 |
| ssb | Neisseria gonorrhoeae MS11 |
43.796 |
91.946 |
0.403 |