Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | OR610_RS05900 | Genome accession | NZ_CP112893 |
| Coordinates | 1240428..1240880 (+) | Length | 150 a.a. |
| NCBI ID | WP_014390703.1 | Uniprot ID | - |
| Organism | Pasteurella multocida strain PF15 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1185822..1244754 | 1240428..1240880 | within | 0 |
Gene organization within MGE regions
Location: 1185822..1244754
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OR610_RS05535 (OR610_05535) | - | 1185822..1186292 (+) | 471 | WP_005717460.1 | FxsA family protein | - |
| OR610_RS05540 (OR610_05540) | - | 1186381..1186671 (+) | 291 | WP_005717461.1 | co-chaperone GroES | - |
| OR610_RS05545 (OR610_05545) | groL | 1186767..1188410 (+) | 1644 | WP_005717462.1 | chaperonin GroEL | - |
| OR610_RS05550 (OR610_05550) | modA | 1188545..1189282 (+) | 738 | WP_005723309.1 | molybdate ABC transporter substrate-binding protein | - |
| OR610_RS05555 (OR610_05555) | - | 1189257..1190054 (+) | 798 | WP_005723310.1 | ABC transporter permease | - |
| OR610_RS05560 (OR610_05560) | - | 1190056..1190655 (+) | 600 | WP_010907021.1 | ABC transporter ATP-binding protein | - |
| OR610_RS05565 (OR610_05565) | modD | 1190673..1191521 (+) | 849 | WP_005757236.1 | ModD protein | - |
| OR610_RS05570 (OR610_05570) | - | 1191617..1193449 (-) | 1833 | WP_005754621.1 | DEAD/DEAH box helicase | - |
| OR610_RS05575 (OR610_05575) | nlpI | 1193557..1194453 (-) | 897 | WP_010907022.1 | lipoprotein NlpI | - |
| OR610_RS05580 (OR610_05580) | pnp | 1194537..1196681 (-) | 2145 | WP_005723319.1 | polyribonucleotide nucleotidyltransferase | - |
| OR610_RS05585 (OR610_05585) | - | 1197367..1197879 (+) | 513 | WP_014390763.1 | hypothetical protein | - |
| OR610_RS05590 (OR610_05590) | - | 1197879..1198625 (+) | 747 | WP_014390762.1 | hypothetical protein | - |
| OR610_RS05595 (OR610_05595) | - | 1199016..1199339 (-) | 324 | WP_014667801.1 | hypothetical protein | - |
| OR610_RS05600 (OR610_05600) | - | 1199387..1201057 (-) | 1671 | WP_267174698.1 | DUF1983 domain-containing protein | - |
| OR610_RS05605 (OR610_05605) | - | 1201224..1205280 (-) | 4057 | Protein_1077 | phage tail protein | - |
| OR610_RS05610 (OR610_05610) | - | 1205284..1205904 (-) | 621 | WP_014667799.1 | tail assembly protein | - |
| OR610_RS05615 (OR610_05615) | - | 1205847..1206590 (-) | 744 | WP_267174700.1 | C40 family peptidase | - |
| OR610_RS05620 (OR610_05620) | - | 1206595..1207299 (-) | 705 | WP_078801828.1 | phage minor tail protein L | - |
| OR610_RS05625 (OR610_05625) | - | 1207428..1207757 (-) | 330 | WP_014390756.1 | phage tail protein | - |
| OR610_RS05630 (OR610_05630) | - | 1207760..1209163 (-) | 1404 | WP_267174701.1 | hypothetical protein | - |
| OR610_RS05635 (OR610_05635) | - | 1209245..1210204 (-) | 960 | WP_267174702.1 | phage tail length tape measure family protein | - |
| OR610_RS05640 (OR610_05640) | - | 1210256..1211080 (-) | 825 | WP_014390754.1 | phage antirepressor N-terminal domain-containing protein | - |
| OR610_RS05645 (OR610_05645) | - | 1211419..1212237 (+) | 819 | WP_014390752.1 | hypothetical protein | - |
| OR610_RS05650 (OR610_05650) | - | 1212313..1212669 (-) | 357 | WP_014390751.1 | TM2 domain-containing protein | - |
| OR610_RS05655 (OR610_05655) | - | 1212746..1213417 (-) | 672 | WP_014390750.1 | DUF6246 family protein | - |
| OR610_RS05660 (OR610_05660) | - | 1213471..1213953 (-) | 483 | WP_014390749.1 | phage tail tube protein | - |
| OR610_RS05665 (OR610_05665) | - | 1213965..1214336 (-) | 372 | WP_014390748.1 | hypothetical protein | - |
| OR610_RS05670 (OR610_05670) | - | 1214333..1214704 (-) | 372 | WP_014390747.1 | hypothetical protein | - |
| OR610_RS05675 (OR610_05675) | - | 1214709..1215053 (-) | 345 | WP_014390746.1 | hypothetical protein | - |
| OR610_RS05680 (OR610_05680) | - | 1215056..1215424 (-) | 369 | WP_014390745.1 | hypothetical protein | - |
| OR610_RS05685 (OR610_05685) | - | 1215405..1215899 (-) | 495 | WP_267174703.1 | hypothetical protein | - |
| OR610_RS05690 (OR610_05690) | - | 1215910..1216908 (-) | 999 | WP_078801825.1 | major capsid protein | - |
| OR610_RS05695 (OR610_05695) | - | 1216920..1217354 (-) | 435 | WP_014390742.1 | hypothetical protein | - |
| OR610_RS05700 (OR610_05700) | - | 1217354..1218700 (-) | 1347 | WP_014390741.1 | DUF2213 domain-containing protein | - |
| OR610_RS05705 (OR610_05705) | - | 1218715..1219686 (-) | 972 | WP_014390740.1 | phage minor head protein | - |
| OR610_RS05710 (OR610_05710) | - | 1219640..1221085 (-) | 1446 | WP_014390739.1 | anti-CBASS protein Acb1 family protein | - |
| OR610_RS05715 (OR610_05715) | - | 1221100..1222326 (-) | 1227 | WP_078801824.1 | PBSX family phage terminase large subunit | - |
| OR610_RS05720 (OR610_05720) | - | 1222310..1222807 (-) | 498 | WP_014390737.1 | terminase | - |
| OR610_RS05725 (OR610_05725) | - | 1222890..1223072 (+) | 183 | WP_016533497.1 | type II toxin-antitoxin system HicA family toxin | - |
| OR610_RS05730 (OR610_05730) | - | 1223101..1223535 (+) | 435 | WP_014390736.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| OR610_RS05735 (OR610_05735) | - | 1223757..1224080 (-) | 324 | WP_078801840.1 | DUF2570 family protein | - |
| OR610_RS05740 (OR610_05740) | - | 1224053..1224583 (-) | 531 | WP_078737811.1 | lysozyme | - |
| OR610_RS05745 (OR610_05745) | - | 1224580..1224840 (-) | 261 | WP_014391475.1 | HP1 family phage holin | - |
| OR610_RS05755 (OR610_05755) | - | 1225167..1225628 (-) | 462 | WP_078801823.1 | antiterminator Q family protein | - |
| OR610_RS05760 (OR610_05760) | - | 1225630..1226232 (-) | 603 | WP_267174704.1 | recombination protein NinG | - |
| OR610_RS05765 (OR610_05765) | - | 1226225..1226440 (-) | 216 | WP_078801821.1 | hypothetical protein | - |
| OR610_RS05770 (OR610_05770) | - | 1226600..1227037 (-) | 438 | WP_267174713.1 | DUF1367 family protein | - |
| OR610_RS05775 (OR610_05775) | - | 1227046..1227576 (-) | 531 | WP_267174705.1 | MT-A70 family methyltransferase | - |
| OR610_RS05780 (OR610_05780) | - | 1227569..1228264 (-) | 696 | WP_078802167.1 | replication protein P | - |
| OR610_RS05785 (OR610_05785) | - | 1228264..1229166 (-) | 903 | WP_078802168.1 | hypothetical protein | - |
| OR610_RS05790 (OR610_05790) | - | 1229168..1229521 (-) | 354 | WP_014390722.1 | HNH endonuclease | - |
| OR610_RS05795 (OR610_05795) | - | 1229518..1230201 (-) | 684 | WP_267174706.1 | phage antirepressor KilAC domain-containing protein | - |
| OR610_RS05800 (OR610_05800) | - | 1230253..1230705 (-) | 453 | WP_014390720.1 | phage regulatory CII family protein | - |
| OR610_RS05805 (OR610_05805) | - | 1230755..1230952 (-) | 198 | WP_014390719.1 | helix-turn-helix domain-containing protein | - |
| OR610_RS05810 (OR610_05810) | - | 1231076..1231753 (+) | 678 | WP_014390718.1 | XRE family transcriptional regulator | - |
| OR610_RS05815 (OR610_05815) | - | 1231886..1232812 (+) | 927 | WP_078737817.1 | hypothetical protein | - |
| OR610_RS05820 (OR610_05820) | - | 1232787..1233140 (+) | 354 | WP_078737818.1 | STAS-like domain-containing protein | - |
| OR610_RS05825 (OR610_05825) | - | 1233140..1233532 (+) | 393 | WP_078737819.1 | hypothetical protein | - |
| OR610_RS05830 (OR610_05830) | - | 1233525..1233782 (-) | 258 | WP_078737820.1 | hypothetical protein | - |
| OR610_RS05835 (OR610_05835) | - | 1234173..1234340 (-) | 168 | WP_005756653.1 | YegP family protein | - |
| OR610_RS05840 (OR610_05840) | - | 1234353..1234562 (+) | 210 | WP_005756656.1 | hypothetical protein | - |
| OR610_RS05845 (OR610_05845) | - | 1234804..1235034 (+) | 231 | WP_075271373.1 | hypothetical protein | - |
| OR610_RS05850 (OR610_05850) | - | 1235047..1235217 (+) | 171 | WP_014391460.1 | hypothetical protein | - |
| OR610_RS05855 (OR610_05855) | - | 1235198..1235392 (-) | 195 | WP_014391459.1 | hypothetical protein | - |
| OR610_RS05865 (OR610_05865) | - | 1236124..1236666 (+) | 543 | WP_078737823.1 | DUF4760 domain-containing protein | - |
| OR610_RS05870 (OR610_05870) | - | 1236948..1237631 (+) | 684 | WP_078737824.1 | Bro-N domain-containing protein | - |
| OR610_RS05875 (OR610_05875) | - | 1237717..1237965 (+) | 249 | WP_078737825.1 | hypothetical protein | - |
| OR610_RS05880 (OR610_05880) | - | 1238131..1238292 (+) | 162 | WP_167383025.1 | hypothetical protein | - |
| OR610_RS05885 (OR610_05885) | - | 1238433..1239020 (+) | 588 | WP_078737827.1 | hypothetical protein | - |
| OR610_RS05890 (OR610_05890) | - | 1239023..1239673 (+) | 651 | WP_267174441.1 | ribonuclease H-like domain-containing protein | - |
| OR610_RS05895 (OR610_05895) | - | 1239716..1240417 (+) | 702 | WP_014390704.1 | ERF family protein | - |
| OR610_RS05900 (OR610_05900) | ssb | 1240428..1240880 (+) | 453 | WP_014390703.1 | single-stranded DNA-binding protein | Machinery gene |
| OR610_RS05905 (OR610_05905) | rdgC | 1241018..1241920 (+) | 903 | WP_014667784.1 | recombination-associated protein RdgC | - |
| OR610_RS05910 (OR610_05910) | - | 1242064..1242594 (+) | 531 | WP_225529740.1 | DUF551 domain-containing protein | - |
| OR610_RS05915 (OR610_05915) | - | 1242747..1242911 (+) | 165 | WP_267174442.1 | hypothetical protein | - |
| OR610_RS05920 (OR610_05920) | - | 1242957..1243412 (+) | 456 | WP_267174443.1 | pyruvate kinase | - |
| OR610_RS05925 (OR610_05925) | - | 1243487..1243768 (+) | 282 | WP_071523558.1 | hypothetical protein | - |
| OR610_RS05930 (OR610_05930) | - | 1243765..1244754 (-) | 990 | WP_075266281.1 | tyrosine-type recombinase/integrase | - |
Sequence
Protein
Download Length: 150 a.a. Molecular weight: 17063.94 Da Isoelectric Point: 7.9707
>NTDB_id=758729 OR610_RS05900 WP_014390703.1 1240428..1240880(+) (ssb) [Pasteurella multocida strain PF15]
MAGVNKVIIVGNLGNDPEIRTMPNGDPVAKISVATSESWIDKNTGERKTQTEWHSIVFYRRQAEICGQYLKKGSKVYVEG
RLRTRKWQDQNGQDRYTTEIQGDVLQMLDSRQDSQQQQAQAPQNNAYANAKAGKPVQQQAYNFEEDNIPF
MAGVNKVIIVGNLGNDPEIRTMPNGDPVAKISVATSESWIDKNTGERKTQTEWHSIVFYRRQAEICGQYLKKGSKVYVEG
RLRTRKWQDQNGQDRYTTEIQGDVLQMLDSRQDSQQQQAQAPQNNAYANAKAGKPVQQQAYNFEEDNIPF
Nucleotide
Download Length: 453 bp
>NTDB_id=758729 OR610_RS05900 WP_014390703.1 1240428..1240880(+) (ssb) [Pasteurella multocida strain PF15]
ATGGCAGGTGTTAATAAAGTAATTATCGTGGGAAATTTGGGAAACGATCCTGAAATCCGCACAATGCCAAATGGCGACCC
TGTTGCAAAAATCAGCGTCGCAACCAGTGAAAGCTGGATCGACAAAAATACTGGCGAACGAAAAACACAAACTGAATGGC
ATTCTATCGTGTTCTATCGTCGCCAAGCAGAAATTTGCGGTCAGTATCTCAAAAAAGGATCGAAAGTGTATGTGGAAGGG
CGTTTAAGAACTCGTAAATGGCAAGACCAAAACGGGCAAGACCGCTACACCACAGAGATTCAAGGCGACGTATTACAAAT
GCTAGACAGTCGCCAAGATTCACAGCAACAGCAAGCACAGGCACCACAAAATAATGCTTATGCGAATGCGAAAGCTGGAA
AGCCTGTACAGCAACAAGCATATAACTTTGAAGAGGATAATATCCCATTCTGA
ATGGCAGGTGTTAATAAAGTAATTATCGTGGGAAATTTGGGAAACGATCCTGAAATCCGCACAATGCCAAATGGCGACCC
TGTTGCAAAAATCAGCGTCGCAACCAGTGAAAGCTGGATCGACAAAAATACTGGCGAACGAAAAACACAAACTGAATGGC
ATTCTATCGTGTTCTATCGTCGCCAAGCAGAAATTTGCGGTCAGTATCTCAAAAAAGGATCGAAAGTGTATGTGGAAGGG
CGTTTAAGAACTCGTAAATGGCAAGACCAAAACGGGCAAGACCGCTACACCACAGAGATTCAAGGCGACGTATTACAAAT
GCTAGACAGTCGCCAAGATTCACAGCAACAGCAAGCACAGGCACCACAAAATAATGCTTATGCGAATGCGAAAGCTGGAA
AGCCTGTACAGCAACAAGCATATAACTTTGAAGAGGATAATATCCCATTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Glaesserella parasuis strain SC1401 |
62.222 |
100 |
0.747 |
| ssb | Vibrio cholerae strain A1552 |
53.957 |
92.667 |
0.5 |
| ssb | Neisseria gonorrhoeae MS11 |
46.715 |
91.333 |
0.427 |
| ssb | Neisseria meningitidis MC58 |
46.715 |
91.333 |
0.427 |