Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   ORF34_RS13410 Genome accession   NZ_CP112873
Coordinates   2558315..2558698 (-) Length   127 a.a.
NCBI ID   WP_003230168.1    Uniprot ID   -
Organism   Bacillus subtilis strain O4     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2553315..2563698
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ORF34_RS13370 (ORF34_13370) sinI 2554248..2554421 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  ORF34_RS13375 (ORF34_13375) sinR 2554455..2554790 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  ORF34_RS13380 (ORF34_13380) tasA 2554883..2555668 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  ORF34_RS13385 (ORF34_13385) sipW 2555732..2556304 (-) 573 WP_003246088.1 signal peptidase I SipW -
  ORF34_RS13390 (ORF34_13390) tapA 2556288..2557049 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  ORF34_RS13395 (ORF34_13395) yqzG 2557322..2557648 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  ORF34_RS13400 (ORF34_13400) spoIITA 2557690..2557869 (-) 180 WP_003230176.1 YqzE family protein -
  ORF34_RS13405 (ORF34_13405) comGG 2557940..2558314 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  ORF34_RS13410 (ORF34_13410) comGF 2558315..2558698 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  ORF34_RS13415 (ORF34_13415) comGE 2558724..2559071 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  ORF34_RS13420 (ORF34_13420) comGD 2559055..2559486 (-) 432 WP_004398628.1 comG operon protein ComGD Machinery gene
  ORF34_RS13425 (ORF34_13425) comGC 2559476..2559772 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  ORF34_RS13430 (ORF34_13430) comGB 2559786..2560823 (-) 1038 WP_009967727.1 comG operon protein ComGB Machinery gene
  ORF34_RS13435 (ORF34_13435) comGA 2560810..2561880 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  ORF34_RS13440 (ORF34_13440) corA 2562292..2563245 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14281.37 Da        Isoelectric Point: 5.8929

>NTDB_id=758585 ORF34_RS13410 WP_003230168.1 2558315..2558698(-) (comGF) [Bacillus subtilis strain O4]
MLISGSLAAIIHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=758585 ORF34_RS13410 WP_003230168.1 2558315..2558698(-) (comGF) [Bacillus subtilis strain O4]
TTGCTCATATCAGGATCGTTAGCTGCGATTATCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
GGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAATCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAAGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

100

100

1