Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   ORF34_RS13370 Genome accession   NZ_CP112873
Coordinates   2554248..2554421 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain O4     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2549248..2559421
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ORF34_RS13355 (ORF34_13355) gcvT 2550047..2551135 (-) 1089 WP_004398598.1 glycine cleavage system aminomethyltransferase GcvT -
  ORF34_RS13360 (ORF34_13360) hepAA 2551577..2553250 (+) 1674 WP_004398544.1 DEAD/DEAH box helicase -
  ORF34_RS13365 (ORF34_13365) yqhG 2553271..2554065 (+) 795 WP_003230200.1 YqhG family protein -
  ORF34_RS13370 (ORF34_13370) sinI 2554248..2554421 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  ORF34_RS13375 (ORF34_13375) sinR 2554455..2554790 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  ORF34_RS13380 (ORF34_13380) tasA 2554883..2555668 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  ORF34_RS13385 (ORF34_13385) sipW 2555732..2556304 (-) 573 WP_003246088.1 signal peptidase I SipW -
  ORF34_RS13390 (ORF34_13390) tapA 2556288..2557049 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  ORF34_RS13395 (ORF34_13395) yqzG 2557322..2557648 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  ORF34_RS13400 (ORF34_13400) spoIITA 2557690..2557869 (-) 180 WP_003230176.1 YqzE family protein -
  ORF34_RS13405 (ORF34_13405) comGG 2557940..2558314 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  ORF34_RS13410 (ORF34_13410) comGF 2558315..2558698 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  ORF34_RS13415 (ORF34_13415) comGE 2558724..2559071 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=758582 ORF34_RS13370 WP_003230187.1 2554248..2554421(+) (sinI) [Bacillus subtilis strain O4]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=758582 ORF34_RS13370 WP_003230187.1 2554248..2554421(+) (sinI) [Bacillus subtilis strain O4]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1