Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | ORU98_RS10555 | Genome accession | NZ_CP111147 |
| Coordinates | 2180720..2181220 (+) | Length | 166 a.a. |
| NCBI ID | WP_010907419.1 | Uniprot ID | - |
| Organism | Pasteurella multocida strain PF11 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2180720..2233017 | 2180720..2181220 | within | 0 |
Gene organization within MGE regions
Location: 2180720..2233017
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ORU98_RS10555 (ORU98_10555) | ssb | 2180720..2181220 (+) | 501 | WP_010907419.1 | single-stranded DNA-binding protein | Machinery gene |
| ORU98_RS10560 (ORU98_10560) | rdgC | 2181358..2182260 (+) | 903 | WP_225529741.1 | recombination-associated protein RdgC | - |
| ORU98_RS10565 (ORU98_10565) | - | 2182404..2182934 (+) | 531 | WP_225529740.1 | DUF551 domain-containing protein | - |
| ORU98_RS10570 (ORU98_10570) | - | 2182946..2183251 (+) | 306 | WP_108575008.1 | hypothetical protein | - |
| ORU98_RS10575 (ORU98_10575) | - | 2183297..2183740 (+) | 444 | WP_225529739.1 | pyruvate kinase | - |
| ORU98_RS10580 (ORU98_10580) | - | 2183913..2184200 (+) | 288 | WP_230491948.1 | DNA-binding protein | - |
| ORU98_RS10585 (ORU98_10585) | - | 2184110..2185162 (+) | 1053 | WP_250010829.1 | tyrosine-type recombinase/integrase | - |
| ORU98_RS10590 (ORU98_10590) | - | 2185482..2186168 (-) | 687 | WP_225529662.1 | KilA-N domain-containing protein | - |
| ORU98_RS10595 (ORU98_10595) | - | 2186471..2187307 (-) | 837 | WP_014390712.1 | KilA-N domain-containing protein | - |
| ORU98_RS10600 (ORU98_10600) | - | 2187733..2188056 (-) | 324 | WP_014667801.1 | hypothetical protein | - |
| ORU98_RS10605 (ORU98_10605) | - | 2188104..2190665 (-) | 2562 | WP_266208756.1 | DUF1983 domain-containing protein | - |
| ORU98_RS10610 (ORU98_10610) | - | 2190716..2191429 (-) | 714 | WP_266208757.1 | hypothetical protein | - |
| ORU98_RS10615 (ORU98_10615) | - | 2191401..2194001 (-) | 2601 | WP_266208758.1 | host specificity protein J | - |
| ORU98_RS10620 (ORU98_10620) | - | 2194005..2194625 (-) | 621 | WP_014667799.1 | tail assembly protein | - |
| ORU98_RS10625 (ORU98_10625) | - | 2194568..2195311 (-) | 744 | WP_078801829.1 | C40 family peptidase | - |
| ORU98_RS10630 (ORU98_10630) | - | 2195316..2196022 (-) | 707 | Protein_2048 | phage minor tail protein L | - |
| ORU98_RS10635 (ORU98_10635) | - | 2196176..2196742 (-) | 567 | WP_078819667.1 | hypothetical protein | - |
| ORU98_RS10640 (ORU98_10640) | - | 2196814..2197164 (-) | 351 | WP_005719622.1 | phage tail protein | - |
| ORU98_RS10645 (ORU98_10645) | - | 2197161..2199554 (-) | 2394 | WP_225529664.1 | phage tail length tape measure family protein | - |
| ORU98_RS10650 (ORU98_10650) | - | 2199541..2199801 (-) | 261 | WP_075269217.1 | phage tail assembly protein T | - |
| ORU98_RS10655 (ORU98_10655) | - | 2199864..2200253 (-) | 390 | WP_016533230.1 | phage minor tail protein G | - |
| ORU98_RS10660 (ORU98_10660) | - | 2200259..2200765 (-) | 507 | WP_078819785.1 | phage tail tube protein | - |
| ORU98_RS10665 (ORU98_10665) | gpU | 2200762..2201169 (-) | 408 | WP_014391486.1 | phage tail terminator protein | - |
| ORU98_RS10670 (ORU98_10670) | - | 2201166..2201717 (-) | 552 | WP_014391485.1 | phage tail protein | - |
| ORU98_RS10675 (ORU98_10675) | - | 2201717..2202010 (-) | 294 | WP_014391484.1 | hypothetical protein | - |
| ORU98_RS10680 (ORU98_10680) | - | 2202003..2202329 (-) | 327 | WP_016570083.1 | DUF2190 family protein | - |
| ORU98_RS10685 (ORU98_10685) | - | 2202402..2204411 (-) | 2010 | WP_078819665.1 | ClpP-like prohead protease/major capsid protein fusion protein | - |
| ORU98_RS10690 (ORU98_10690) | - | 2204347..2205885 (-) | 1539 | WP_266208759.1 | phage portal protein | - |
| ORU98_RS10695 (ORU98_10695) | - | 2205882..2206103 (-) | 222 | WP_014391481.1 | hypothetical protein | - |
| ORU98_RS10700 (ORU98_10700) | - | 2206100..2208208 (-) | 2109 | WP_014391480.1 | phage terminase large subunit family protein | - |
| ORU98_RS10705 (ORU98_10705) | - | 2208212..2208685 (-) | 474 | WP_014391479.1 | DUF1441 family protein | - |
| ORU98_RS10710 (ORU98_10710) | - | 2208975..2209235 (+) | 261 | WP_005720780.1 | type II toxin-antitoxin system RelE family toxin | - |
| ORU98_RS10715 (ORU98_10715) | - | 2209271..2209639 (+) | 369 | WP_014391478.1 | helix-turn-helix domain-containing protein | - |
| ORU98_RS10720 (ORU98_10720) | - | 2209849..2210172 (-) | 324 | WP_078801840.1 | DUF2570 family protein | - |
| ORU98_RS10725 (ORU98_10725) | - | 2210145..2210675 (-) | 531 | WP_069915984.1 | lysozyme | - |
| ORU98_RS10730 (ORU98_10730) | - | 2210672..2210929 (-) | 258 | WP_081376958.1 | HP1 family phage holin | - |
| ORU98_RS10735 (ORU98_10735) | - | 2211047..2211610 (+) | 564 | WP_014667793.1 | hypothetical protein | - |
| ORU98_RS10740 (ORU98_10740) | - | 2211736..2212197 (-) | 462 | WP_225529665.1 | antiterminator Q family protein | - |
| ORU98_RS10745 (ORU98_10745) | - | 2212198..2212800 (-) | 603 | WP_170376544.1 | recombination protein NinG | - |
| ORU98_RS10750 (ORU98_10750) | - | 2212793..2213008 (-) | 216 | WP_225529666.1 | hypothetical protein | - |
| ORU98_RS10755 (ORU98_10755) | - | 2213082..2213540 (-) | 459 | WP_014391471.1 | recombination protein NinB | - |
| ORU98_RS10760 (ORU98_10760) | - | 2213530..2214066 (-) | 537 | WP_178384709.1 | phage N-6-adenine-methyltransferase | - |
| ORU98_RS10765 (ORU98_10765) | - | 2214070..2214759 (-) | 690 | WP_225529667.1 | replication protein P | - |
| ORU98_RS10770 (ORU98_10770) | - | 2214759..2215595 (-) | 837 | WP_225529668.1 | helix-turn-helix domain-containing protein | - |
| ORU98_RS10775 (ORU98_10775) | - | 2215592..2215807 (-) | 216 | WP_075271368.1 | hypothetical protein | - |
| ORU98_RS10780 (ORU98_10780) | - | 2215804..2216487 (-) | 684 | WP_014390721.1 | phage antirepressor KilAC domain-containing protein | - |
| ORU98_RS10785 (ORU98_10785) | - | 2216545..2216994 (-) | 450 | WP_099821840.1 | YmfL family putative regulatory protein | - |
| ORU98_RS10790 (ORU98_10790) | - | 2217043..2217243 (-) | 201 | WP_099821841.1 | YdaS family helix-turn-helix protein | - |
| ORU98_RS10795 (ORU98_10795) | - | 2217368..2218051 (+) | 684 | WP_099821842.1 | helix-turn-helix transcriptional regulator | - |
| ORU98_RS10800 (ORU98_10800) | - | 2218262..2220106 (+) | 1845 | WP_071523830.1 | DEAD/DEAH box helicase | - |
| ORU98_RS10805 (ORU98_10805) | - | 2220136..2220540 (+) | 405 | WP_146024473.1 | hypothetical protein | - |
| ORU98_RS10810 (ORU98_10810) | - | 2220566..2220856 (-) | 291 | WP_078819686.1 | addiction module antidote protein | - |
| ORU98_RS10815 (ORU98_10815) | - | 2220853..2221167 (-) | 315 | WP_078819687.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| ORU98_RS10820 (ORU98_10820) | - | 2221473..2221640 (-) | 168 | WP_005756653.1 | YegP family protein | - |
| ORU98_RS10825 (ORU98_10825) | - | 2221653..2221862 (+) | 210 | WP_005756656.1 | hypothetical protein | - |
| ORU98_RS10830 (ORU98_10830) | - | 2222104..2222334 (+) | 231 | WP_078737821.1 | hypothetical protein | - |
| ORU98_RS10835 (ORU98_10835) | - | 2222347..2222517 (+) | 171 | WP_225529669.1 | hypothetical protein | - |
| ORU98_RS10840 (ORU98_10840) | - | 2222498..2222692 (-) | 195 | WP_014391459.1 | hypothetical protein | - |
| ORU98_RS10845 (ORU98_10845) | - | 2223056..2223433 (+) | 378 | Protein_2091 | Bro-N domain-containing protein | - |
| ORU98_RS10850 (ORU98_10850) | - | 2223764..2224330 (+) | 567 | Protein_2092 | KilA-N domain-containing protein | - |
| ORU98_RS10855 (ORU98_10855) | - | 2224392..2224622 (-) | 231 | WP_223251317.1 | hypothetical protein | - |
| ORU98_RS10860 (ORU98_10860) | - | 2224770..2225069 (+) | 300 | WP_078802174.1 | hypothetical protein | - |
| ORU98_RS10865 (ORU98_10865) | - | 2225041..2225277 (+) | 237 | WP_075271355.1 | hypothetical protein | - |
| ORU98_RS10870 (ORU98_10870) | - | 2225290..2225577 (+) | 288 | WP_014391452.1 | hypothetical protein | - |
| ORU98_RS10875 (ORU98_10875) | - | 2225579..2226532 (+) | 954 | WP_014391451.1 | recombinase RecT | - |
| ORU98_RS10880 (ORU98_10880) | - | 2226519..2227178 (+) | 660 | WP_041423209.1 | translocation protein TolB precursor | - |
| ORU98_RS10885 (ORU98_10885) | ssb | 2227178..2227627 (+) | 450 | WP_266199913.1 | single-stranded DNA-binding protein | Machinery gene |
| ORU98_RS10890 (ORU98_10890) | - | 2227777..2228778 (+) | 1002 | WP_266208760.1 | site-specific integrase | - |
| ORU98_RS10895 (ORU98_10895) | - | 2228840..2229058 (+) | 219 | WP_239990816.1 | hypothetical protein | - |
| ORU98_RS10900 (ORU98_10900) | - | 2229045..2230565 (+) | 1521 | WP_010907418.1 | site-specific integrase | - |
| ORU98_RS10905 (ORU98_10905) | - | 2230568..2231146 (+) | 579 | WP_266208761.1 | hypothetical protein | - |
| ORU98_RS10910 (ORU98_10910) | - | 2231115..2232605 (+) | 1491 | WP_266208762.1 | integrase | - |
| ORU98_RS10915 (ORU98_10915) | - | 2232607..2233017 (+) | 411 | WP_010907416.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 166 a.a. Molecular weight: 18687.70 Da Isoelectric Point: 5.3353
>NTDB_id=758210 ORU98_RS10555 WP_010907419.1 2180720..2181220(+) (ssb) [Pasteurella multocida strain PF11]
MAGVNKVIIVGNLGNDPEIRTMPNGEAVANISVATSESWIDKNTNERREVTEWHRIVFYRRQAEVAGEYLRKGSKVYVEG
RLKTRKWQDQNGQDRYTTEIQGDVLQMLDSRNERQQTGGYAPQTAAPQYNAPTGSYGAQPSRPATKPAPQNEPPMDMGFE
EDNIPF
MAGVNKVIIVGNLGNDPEIRTMPNGEAVANISVATSESWIDKNTNERREVTEWHRIVFYRRQAEVAGEYLRKGSKVYVEG
RLKTRKWQDQNGQDRYTTEIQGDVLQMLDSRNERQQTGGYAPQTAAPQYNAPTGSYGAQPSRPATKPAPQNEPPMDMGFE
EDNIPF
Nucleotide
Download Length: 501 bp
>NTDB_id=758210 ORU98_RS10555 WP_010907419.1 2180720..2181220(+) (ssb) [Pasteurella multocida strain PF11]
ATGGCTGGAGTAAATAAAGTAATTATTGTAGGAAACTTAGGTAACGATCCTGAAATCCGCACAATGCCAAATGGTGAAGC
CGTAGCCAATATCAGCGTCGCGACCAGTGAAAGCTGGATCGACAAAAATACTAACGAACGTCGTGAAGTCACCGAATGGC
ATCGCATCGTATTCTACCGTCGCCAAGCTGAAGTGGCTGGGGAATATCTGCGTAAAGGTTCAAAAGTGTATGTAGAGGGA
CGCCTAAAAACCCGTAAATGGCAAGACCAAAATGGGCAAGATCGCTACACTACCGAAATCCAAGGCGACGTGTTGCAAAT
GCTCGACAGCCGTAACGAACGTCAACAAACCGGCGGCTATGCCCCACAAACCGCTGCGCCACAATATAATGCCCCAACAG
GTAGCTACGGTGCACAACCTTCTCGTCCAGCGACAAAACCCGCTCCACAAAACGAACCTCCAATGGACATGGGCTTTGAG
GAAGATAATATTCCGTTTTGA
ATGGCTGGAGTAAATAAAGTAATTATTGTAGGAAACTTAGGTAACGATCCTGAAATCCGCACAATGCCAAATGGTGAAGC
CGTAGCCAATATCAGCGTCGCGACCAGTGAAAGCTGGATCGACAAAAATACTAACGAACGTCGTGAAGTCACCGAATGGC
ATCGCATCGTATTCTACCGTCGCCAAGCTGAAGTGGCTGGGGAATATCTGCGTAAAGGTTCAAAAGTGTATGTAGAGGGA
CGCCTAAAAACCCGTAAATGGCAAGACCAAAATGGGCAAGATCGCTACACTACCGAAATCCAAGGCGACGTGTTGCAAAT
GCTCGACAGCCGTAACGAACGTCAACAAACCGGCGGCTATGCCCCACAAACCGCTGCGCCACAATATAATGCCCCAACAG
GTAGCTACGGTGCACAACCTTCTCGTCCAGCGACAAAACCCGCTCCACAAAACGAACCTCCAATGGACATGGGCTTTGAG
GAAGATAATATTCCGTTTTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Glaesserella parasuis strain SC1401 |
68.681 |
100 |
0.753 |
| ssb | Vibrio cholerae strain A1552 |
54.144 |
100 |
0.59 |
| ssb | Neisseria meningitidis MC58 |
44.068 |
100 |
0.47 |
| ssb | Neisseria gonorrhoeae MS11 |
44.068 |
100 |
0.47 |