Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | ORU25_RS07200 | Genome accession | NZ_CP111145 |
| Coordinates | 1429648..1430097 (-) | Length | 149 a.a. |
| NCBI ID | WP_266199913.1 | Uniprot ID | - |
| Organism | Pasteurella multocida strain PF9 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1425507..1467984 | 1429648..1430097 | within | 0 |
Gene organization within MGE regions
Location: 1425507..1467984
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ORU25_RS07165 (ORU25_07165) | - | 1425507..1426496 (+) | 990 | WP_075266281.1 | tyrosine-type recombinase/integrase | - |
| ORU25_RS07170 (ORU25_07170) | - | 1426493..1426774 (-) | 282 | WP_071523558.1 | hypothetical protein | - |
| ORU25_RS07175 (ORU25_07175) | - | 1426849..1427298 (-) | 450 | WP_266199916.1 | pyruvate kinase | - |
| ORU25_RS07180 (ORU25_07180) | - | 1427305..1427571 (-) | 267 | WP_064702824.1 | hypothetical protein | - |
| ORU25_RS07185 (ORU25_07185) | - | 1427617..1427922 (-) | 306 | WP_108575008.1 | hypothetical protein | - |
| ORU25_RS07190 (ORU25_07190) | - | 1427934..1428464 (-) | 531 | WP_266199915.1 | DUF551 domain-containing protein | - |
| ORU25_RS07195 (ORU25_07195) | rdgC | 1428608..1429510 (-) | 903 | WP_014667784.1 | recombination-associated protein RdgC | - |
| ORU25_RS07200 (ORU25_07200) | ssb | 1429648..1430097 (-) | 450 | WP_266199913.1 | single-stranded DNA-binding protein | Machinery gene |
| ORU25_RS07205 (ORU25_07205) | - | 1430097..1430756 (-) | 660 | WP_041423209.1 | translocation protein TolB precursor | - |
| ORU25_RS07210 (ORU25_07210) | - | 1430743..1431694 (-) | 952 | Protein_1401 | recombinase RecT | - |
| ORU25_RS07215 (ORU25_07215) | - | 1431696..1431983 (-) | 288 | WP_014391452.1 | hypothetical protein | - |
| ORU25_RS07220 (ORU25_07220) | - | 1431996..1432232 (-) | 237 | WP_078801815.1 | hypothetical protein | - |
| ORU25_RS07225 (ORU25_07225) | - | 1432204..1432503 (-) | 300 | WP_014391453.1 | hypothetical protein | - |
| ORU25_RS07230 (ORU25_07230) | - | 1432651..1432881 (+) | 231 | WP_223251317.1 | hypothetical protein | - |
| ORU25_RS07235 (ORU25_07235) | - | 1432943..1433605 (-) | 663 | WP_078737830.1 | KilA-N domain-containing protein | - |
| ORU25_RS07240 (ORU25_07240) | - | 1433852..1434115 (-) | 264 | WP_071522857.1 | hypothetical protein | - |
| ORU25_RS07245 (ORU25_07245) | - | 1434327..1434521 (+) | 195 | WP_078737822.1 | hypothetical protein | - |
| ORU25_RS07250 (ORU25_07250) | - | 1434502..1434672 (-) | 171 | WP_155295599.1 | hypothetical protein | - |
| ORU25_RS07255 (ORU25_07255) | - | 1434685..1434915 (-) | 231 | WP_078737821.1 | hypothetical protein | - |
| ORU25_RS07260 (ORU25_07260) | - | 1435157..1435366 (-) | 210 | WP_005756656.1 | hypothetical protein | - |
| ORU25_RS07265 (ORU25_07265) | - | 1435379..1435546 (+) | 168 | WP_005756653.1 | YegP family protein | - |
| ORU25_RS07270 (ORU25_07270) | - | 1435851..1436165 (+) | 315 | WP_078819687.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| ORU25_RS07275 (ORU25_07275) | - | 1436162..1436452 (+) | 291 | WP_078819686.1 | addiction module antidote protein | - |
| ORU25_RS07280 (ORU25_07280) | - | 1436478..1436882 (-) | 405 | WP_146024473.1 | hypothetical protein | - |
| ORU25_RS07285 (ORU25_07285) | - | 1436912..1438756 (-) | 1845 | WP_071523830.1 | DEAD/DEAH box helicase | - |
| ORU25_RS07290 (ORU25_07290) | - | 1438967..1439644 (-) | 678 | WP_014390718.1 | XRE family transcriptional regulator | - |
| ORU25_RS07295 (ORU25_07295) | - | 1439768..1439965 (+) | 198 | WP_014390719.1 | helix-turn-helix domain-containing protein | - |
| ORU25_RS07300 (ORU25_07300) | - | 1440015..1440476 (+) | 462 | WP_078802159.1 | phage regulatory CII family protein | - |
| ORU25_RS07305 (ORU25_07305) | - | 1440537..1441220 (+) | 684 | WP_078802160.1 | phage antirepressor KilAC domain-containing protein | - |
| ORU25_RS07310 (ORU25_07310) | - | 1441217..1441432 (+) | 216 | WP_075271368.1 | hypothetical protein | - |
| ORU25_RS07315 (ORU25_07315) | - | 1441429..1442244 (+) | 816 | WP_266199956.1 | helix-turn-helix domain-containing protein | - |
| ORU25_RS07320 (ORU25_07320) | - | 1442244..1442996 (+) | 753 | WP_266206421.1 | replication protein P | - |
| ORU25_RS07325 (ORU25_07325) | - | 1442936..1443472 (+) | 537 | WP_178384709.1 | phage N-6-adenine-methyltransferase | - |
| ORU25_RS07330 (ORU25_07330) | - | 1443462..1443920 (+) | 459 | WP_014391471.1 | recombination protein NinB | - |
| ORU25_RS07335 (ORU25_07335) | - | 1443994..1444209 (+) | 216 | WP_014667790.1 | hypothetical protein | - |
| ORU25_RS07340 (ORU25_07340) | - | 1444202..1444804 (+) | 603 | WP_250058251.1 | recombination protein NinG | - |
| ORU25_RS07345 (ORU25_07345) | - | 1444806..1445267 (+) | 462 | WP_241952116.1 | antiterminator Q family protein | - |
| ORU25_RS07350 (ORU25_07350) | - | 1445398..1445592 (+) | 195 | WP_064964940.1 | hypothetical protein | - |
| ORU25_RS07355 (ORU25_07355) | - | 1446073..1446333 (+) | 261 | WP_014391475.1 | HP1 family phage holin | - |
| ORU25_RS07360 (ORU25_07360) | - | 1446330..1446860 (+) | 531 | WP_078737811.1 | lysozyme | - |
| ORU25_RS07365 (ORU25_07365) | - | 1446833..1447156 (+) | 324 | WP_078801840.1 | DUF2570 family protein | - |
| ORU25_RS07370 (ORU25_07370) | - | 1447366..1447734 (-) | 369 | WP_014391478.1 | helix-turn-helix domain-containing protein | - |
| ORU25_RS07375 (ORU25_07375) | - | 1447770..1448030 (-) | 261 | WP_005720780.1 | type II toxin-antitoxin system RelE family toxin | - |
| ORU25_RS07380 (ORU25_07380) | - | 1448320..1448793 (+) | 474 | WP_078819784.1 | DUF1441 family protein | - |
| ORU25_RS07385 (ORU25_07385) | - | 1448797..1450905 (+) | 2109 | WP_014391480.1 | phage terminase large subunit family protein | - |
| ORU25_RS07390 (ORU25_07390) | - | 1450902..1451123 (+) | 222 | WP_014391481.1 | hypothetical protein | - |
| ORU25_RS07395 (ORU25_07395) | - | 1451120..1452658 (+) | 1539 | WP_016533224.1 | phage portal protein | - |
| ORU25_RS07400 (ORU25_07400) | - | 1452594..1454603 (+) | 2010 | WP_078819665.1 | ClpP-like prohead protease/major capsid protein fusion protein | - |
| ORU25_RS07405 (ORU25_07405) | - | 1454676..1455002 (+) | 327 | WP_266199907.1 | DUF2190 family protein | - |
| ORU25_RS07410 (ORU25_07410) | - | 1454995..1455288 (+) | 294 | WP_014391484.1 | hypothetical protein | - |
| ORU25_RS07415 (ORU25_07415) | - | 1455288..1455839 (+) | 552 | WP_014391485.1 | phage tail protein | - |
| ORU25_RS07420 (ORU25_07420) | gpU | 1455836..1456243 (+) | 408 | WP_014391486.1 | phage tail terminator protein | - |
| ORU25_RS07425 (ORU25_07425) | - | 1456240..1456746 (+) | 507 | WP_078819785.1 | phage tail tube protein | - |
| ORU25_RS07430 (ORU25_07430) | - | 1456752..1457141 (+) | 390 | WP_016533230.1 | phage minor tail protein G | - |
| ORU25_RS07435 (ORU25_07435) | - | 1457162..1457464 (+) | 303 | WP_225529681.1 | phage tail assembly protein T | - |
| ORU25_RS07440 (ORU25_07440) | - | 1457451..1459823 (+) | 2373 | WP_078819786.1 | phage tail length tape measure family protein | - |
| ORU25_RS07445 (ORU25_07445) | - | 1459820..1460170 (+) | 351 | WP_005719622.1 | phage tail protein | - |
| ORU25_RS07450 (ORU25_07450) | - | 1460242..1460808 (+) | 567 | WP_078819667.1 | hypothetical protein | - |
| ORU25_RS07455 (ORU25_07455) | - | 1460962..1461666 (+) | 705 | WP_078819787.1 | phage minor tail protein L | - |
| ORU25_RS07460 (ORU25_07460) | - | 1461671..1462414 (+) | 744 | WP_078801829.1 | C40 family peptidase | - |
| ORU25_RS07465 (ORU25_07465) | - | 1462357..1462977 (+) | 621 | WP_014667799.1 | tail assembly protein | - |
| ORU25_RS07480 (ORU25_07480) | - | 1462981..1467984 (+) | 5004 | Protein_1453 | phage tail protein | - |
Sequence
Protein
Download Length: 149 a.a. Molecular weight: 17024.90 Da Isoelectric Point: 6.9835
>NTDB_id=758164 ORU25_RS07200 WP_266199913.1 1429648..1430097(-) (ssb) [Pasteurella multocida strain PF9]
MAGVNRVIILGNLGSDPEIRTMPNGDPVAKISVATSESWIDKNTNERKTQTEWHSIVFYRRQAEICGQYLKKGSKVYVEG
KLRTRKWQDQNGQDRYTTEIQGDVLQMLDSRQDSQQQQAQAPQNNAYANAKSGKPVQKFDNFEEDDIPF
MAGVNRVIILGNLGSDPEIRTMPNGDPVAKISVATSESWIDKNTNERKTQTEWHSIVFYRRQAEICGQYLKKGSKVYVEG
KLRTRKWQDQNGQDRYTTEIQGDVLQMLDSRQDSQQQQAQAPQNNAYANAKSGKPVQKFDNFEEDDIPF
Nucleotide
Download Length: 450 bp
>NTDB_id=758164 ORU25_RS07200 WP_266199913.1 1429648..1430097(-) (ssb) [Pasteurella multocida strain PF9]
ATGGCTGGGGTTAATCGTGTAATTATTTTAGGAAATTTAGGAAGCGATCCTGAAATCCGCACAATGCCAAATGGCGACCC
TGTGGCAAAAATCAGTGTGGCCACAAGTGAAAGCTGGATTGATAAAAACACAAACGAACGAAAAACACAAACTGAATGGC
ATTCTATCGTGTTCTATCGTCGCCAAGCAGAAATTTGCGGGCAGTATTTGAAGAAAGGCTCGAAAGTTTATGTGGAAGGT
AAGCTCAGAACACGCAAATGGCAAGATCAAAATGGTCAAGACCGCTACACCACAGAGATTCAAGGCGACGTATTACAAAT
GCTAGACAGTCGCCAAGATTCACAGCAACAGCAAGCACAGGCACCACAAAATAATGCTTATGCGAATGCGAAAAGTGGAA
AACCAGTGCAGAAGTTTGATAATTTTGAAGAAGACGATATACCGTTTTGA
ATGGCTGGGGTTAATCGTGTAATTATTTTAGGAAATTTAGGAAGCGATCCTGAAATCCGCACAATGCCAAATGGCGACCC
TGTGGCAAAAATCAGTGTGGCCACAAGTGAAAGCTGGATTGATAAAAACACAAACGAACGAAAAACACAAACTGAATGGC
ATTCTATCGTGTTCTATCGTCGCCAAGCAGAAATTTGCGGGCAGTATTTGAAGAAAGGCTCGAAAGTTTATGTGGAAGGT
AAGCTCAGAACACGCAAATGGCAAGATCAAAATGGTCAAGACCGCTACACCACAGAGATTCAAGGCGACGTATTACAAAT
GCTAGACAGTCGCCAAGATTCACAGCAACAGCAAGCACAGGCACCACAAAATAATGCTTATGCGAATGCGAAAAGTGGAA
AACCAGTGCAGAAGTTTGATAATTTTGAAGAAGACGATATACCGTTTTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Glaesserella parasuis strain SC1401 |
61.878 |
100 |
0.752 |
| ssb | Vibrio cholerae strain A1552 |
52.518 |
93.289 |
0.49 |
| ssb | Neisseria meningitidis MC58 |
39.548 |
100 |
0.47 |
| ssb | Neisseria gonorrhoeae MS11 |
43.796 |
91.946 |
0.403 |